KEGG   Olsenella uli: Olsu_1361Help
Entry
Olsu_1361         CDS       T01285                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ols  Olsenella uli
Pathway
ols00620  Pyruvate metabolism
ols00680  Methane metabolism
ols01100  Metabolic pathways
ols01120  Microbial metabolism in diverse environments
ols01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ols00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Olsu_1361
  09102 Energy metabolism
   00680 Methane metabolism
    Olsu_1361
Enzymes [BR:ols01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Olsu_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADK68466
UniProt: E1QWG3
LinkDB All DBs
Position
complement(1561163..1563937)
Genome map
AA seq 924 aa AA seqDB search
MSEVDRLKDEVAAAAAEVGVNQAELERAAARTALSQVHIPDDLKENMALFLRLVRKVLTE
YDPELRHAFDALLADAIRANIEEDATSIDSEGRAAAFADAVSIIDSLDVGPATMLTRAFA
AYFHLANICEENYRVKSLRTREQAVPTTEDEDPINDITVAYHQLVDECGRGKALALLNRL
EFHPVFTAHPTEARRKAVEGKIRRISALLEERPRLGGASLAENERRMLEEIDALLRTSPI
AIKKPTPVEEADTILDIFDATLFDMVPEVYRRFDDWELGEKAGTVAPICPAFFHPGSWIG
SDRDGNPNVTARVSRRVAEKFRTHMLETLTEATYRTGRNLTLDASSTKPSDQLLNLWNHQ
VEMSEVLTAHALEVSASELHRAVMIVISNRLEATIGRTADMMYDSAEDYIADLRVVQHSL
AHAGAVRTAYGPLQRLIWQAETFGFHMVEMEFRQHSLVHSRALADIREHGRWGERGELAP
MTKEVLDTFRAIGSIQRKNGVKAARRYIISFTQSPQNVADVYELARLAFAHEQDVPTLDV
IPLFEQVEDLENAVDTLDEVIKLADVQRRLAQTGRRMEVMLGYSDSSKDAGPTSATLVLH
ATQERIARWADENNIDLVLMHGRGGAVGRGGGPANRAVLSQPKGSVNCRFKLTEQGEVIF
ARYGDPTLARRHVESVAGATLLQSAPAIEYINTETTDKYAELAFELDRASRERYLDLLGT
EGFAAWFSTVTPLTEIGLMPIGSRPAKRGLGAKSLDDLRTIPWIFSWSQARTNLAAWYGL
GSACERFGDLERLREAYAEWPLFTTFVDNIEMSLSKTDERIARMYLALGDREDLNAKVLD
EMALTRKWVLAITGNDWPLQNRRVLGPVIRMRLPFVNVLSVMQARALATMRTKGDKLTPE
ERERFIYLILCTVSGVSAGLQNTG
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgaagtcgatcgactgaaggacgaggtcgccgcagctgcggcggaggttggggtc
aaccaggccgagctggagcgcgcggccgcccgaacggcgctgtcccaggtccacatcccg
gacgacctcaaggagaacatggcgctcttcctgcgcctggtgcgcaaggtcctgaccgag
tacgacccagaactgcgccatgccttcgacgccctgctggcggacgccatccgtgccaac
atcgaggaggatgccaccagcatcgacagcgagggccgcgcggccgccttcgccgacgcc
gtctccatcatcgactcgttggacgtcgggcccgcgaccatgctgacgagggcattcgcg
gcctacttccacctggcgaacatctgcgaggagaactatcgcgtcaagtccctgcgcacc
cgcgagcaggccgtccccacgaccgaggacgaggatcccatcaacgacatcacggttgcc
taccaccagctggtggacgagtgcgggcgcggcaaggccctggccctgctcaaccgcctg
gagttccatcccgtcttcaccgcgcatcccacggaggcccgccgcaaggcggtcgagggc
aagatccgtcgcatatccgccctgctcgaggagcgcccgcggctgggcggcgcctcgctg
gccgagaacgagcggcgcatgctcgaggagatcgacgcgctcctgcgcacctcgcccatc
gccatcaagaagccgacccccgtcgaggaggccgacaccatcctcgacatcttcgacgcc
acgctcttcgacatggtgcccgaggtctatcgccgcttcgacgactgggagctgggcgag
aaggccggcaccgtggcgcccatctgccccgcgttcttccacccgggcagctggatcggc
tcggaccgcgacggcaaccccaacgtcaccgccagggtcagccgcagggtggccgagaag
ttccgtacccacatgctcgagaccctgaccgaggccacctatcgcacgggccgcaacctc
acgctcgacgcgtcctcgacgaagccctccgaccagctgctcaacctctggaaccatcag
gtcgagatgagcgaggtcctgaccgcgcacgcgctcgaggtctccgcctccgagctccac
cgtgcggtcatgatcgtgatctccaacaggctcgaggcgaccatcggccgcacggcggac
atgatgtacgactcggccgaggactacatagccgacctgcgcgtcgtccagcactccctt
gcccatgccggcgccgtccgcacggcctacggccccctccagcgcctcatctggcaggcc
gagaccttcggcttccacatggtcgagatggagttccgccagcactcgctggtccactcc
cgtgcccttgccgacattcgcgagcatgggcgctggggcgagcggggcgagctcgcgccc
atgaccaaggaggtcctggacaccttccgcgccatcggttccatacagcgcaagaacggc
gtcaaggcggcgcgacgctacatcatctcgttcacgcagagcccccagaacgtcgcagac
gtctacgagctcgcgcgccttgcgttcgcacacgagcaggacgtgcccaccctcgacgtc
atccccctgttcgagcaggtcgaagacctcgagaacgccgtcgacaccctggacgaggtc
atcaagctcgcggacgtccagcgccgcctggcccagacgggccgcaggatggaggtcatg
ctcggctactccgactcctccaaggacgccggccccacctccgccaccctggtcctgcat
gccacccaggagcgcatcgcccggtgggcggacgagaacaacatcgacctcgtgctgatg
cacggtcgtggcggggccgtcggccgaggcggcggccccgccaaccgtgcggtcctctcg
cagcccaagggctccgtcaactgccgcttcaagctgacggagcagggcgaggtcatcttc
gcccgttacggggaccccaccctggcccgccgccacgtcgagtccgtcgccggcgcgacg
cttctgcagtcggcgcccgccatcgagtacatcaacaccgagaccacggacaagtacgcc
gagctcgcctttgagctcgatcgtgcctcgcgcgagcgctacctggacctccttgggacc
gagggcttcgccgcatggttctcgaccgtcaccccgctgaccgagatcggcctcatgccc
ataggctcgcgtcccgcgaagcgcggactgggcgccaagtccctcgacgacctgcgcacc
ataccctggatcttctcctggtcccaggcgcgcaccaacctcgccgcctggtatggcctg
ggcagcgcctgcgagcgcttcggcgacctggaacgcctgcgcgaggcctatgccgagtgg
ccgctcttcaccacgttcgtcgacaacatcgagatgtcgctctccaagaccgacgagcgc
atcgcgcggatgtacctcgcgctgggcgaccgcgaggatctaaacgccaaggtcctcgac
gagatggccctcaccaggaagtgggtgctcgccatcaccggcaacgactggccgctccag
aaccgtcgcgtcctggggcccgtcatccgcatgcgcctgccgttcgtgaacgtgctctcc
gtgatgcaggcccgtgccctcgccacgatgcgcaccaagggggacaagctcacccccgag
gaacgcgagcgcttcatctacctcatcctctgtaccgtctccggggtgtccgccggtctg
cagaacacggggtga

DBGET integrated database retrieval system