KEGG   Oreochromis niloticus (Nile tilapia): 100695639
Entry
100695639         CDS       T06104                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A
  KO
K04291  lysophosphatidic acid receptor 2
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04080  Neuroactive ligand-receptor interaction
onl04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100695639
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100695639
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:onl04030]
    100695639
G protein-coupled receptors [BR:onl04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    100695639
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 100695639
NCBI-ProteinID: XP_003442008
Ensembl: ENSONIG00000001874
LinkDB
AA seq 351 aa
MATESIVENTCYYNENVTFFYRTVNKTISTGWNTRDYVVIGLGLTVCVIVLLANLLVMIA
IFMNRRFHFPIYYLLGNMAAADLFAGIAYANLMLHTGPWTRTLTKEQWYIRGALIDISLT
ASVANLLAVAVERHQTIITMQLHSTMPKRRVVLLIVCIWAIGIIMGLVPTLWNCECDLKD
CSTLAPLYSRRFLIFWAVLNLLTFFVMVAVYTRIFIYVKNQSKNTSQQVTEIRQQTVVNL
MKTISMVLGAFVICWTPGLVTLLLDGLLGKESHANRYEKYCLFIAECNSLVNPIIYSLRD
NEMRRTFKWILCSLCRRGAHPQRQLSLVTRGTSLREEKLGSGLKSEAEALC
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggccacagagagtattgtggagaatacctgttactacaacgagaatgtcaccttcttc
tacagaacggttaataagacgatcagtacgggatggaatacacgggactatgttgtcatt
ggactgggcttgacagtatgtgttattgtactcctggccaacttgctggtgatgatagcc
atttttatgaaccgccgctttcactttcccatctactatctcctggggaacatggctgca
gcagacctgtttgcaggtattgcctatgccaacctgatgttgcacacaggcccgtggact
agaacccttaccaaggagcagtggtatatccgcggcgctttgattgacatcagcttgaca
gcctctgtggccaacctccttgctgtcgctgtggagcgacaccagaccatcatcaccatg
cagcttcacagcactatgccaaagcggcgtgtggtgctgctgatagtatgcatctgggcc
ataggtatcatcatgggcctggtgccgacactttggaactgtgagtgtgatcttaaggac
tgctccacccttgcgccgctctacagccgccgcttccttatcttctgggcagtcctcaac
ctgctcactttcttcgttatggtggccgtgtatactcgaatctttatctatgtgaagaac
caaagtaagaacacgtctcaacaagtcacagagatccgacagcagaccgttgtcaacctg
atgaagacgatatccatggtcctgggtgcctttgtaatttgctggacgcctggcctcgtg
actctcttactggatggactgttgggtaaagagagtcatgccaaccgctatgagaaatac
tgtttgttcatagcagagtgcaactctctggtcaatcctatcatctattccctacgggac
aacgagatgcggaggacgttcaagtggatcctgtgctctctgtgtcggagaggtgctcat
ccgcagaggcaactttcactagtcacgaggggcacatctctgcgagaggaaaaacttggc
tctggcctgaagtcagaagcagaggccttgtgttag

DBGET integrated database retrieval system