KEGG   Oreochromis niloticus (Nile tilapia): 100695935
Entry
100695935         CDS       T06104                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
onl04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100695935 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100695935 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:onl04052]
    100695935 (kitlg)
Cytokines and growth factors [BR:onl04052]
 Growth factors
  Growth factors (RTK binding)
   100695935 (kitlg)
SSDB
Motif
Pfam: SCF CENP-F_leu_zip
Other DBs
NCBI-GeneID: 100695935
NCBI-ProteinID: XP_005454236
Ensembl: ENSONIG00000003874
UniProt: I3J7P2
LinkDB
AA seq 265 aa
MKKSKSWIHVCVHFLLFITLGVHSDRLNINPVTDDIAKLSTLRQNIPKDYLIPLEYIPKE
EAGMCWMKLNIFYLEESLERLSEKFGNVSSNKENISIFIQILQEQRVHMQDLNDIMLDFE
CHYREERFDTNQYFDFIEDLLRAVENKEDAHDCDVPPCPTSPLTEKYSEESPTPTSNAPL
CPNDCKTSQQQRLLPEVVERSLLSLLFIPLLAIVFLLVWKVRSRRNQDGVQQNPAEEGLT
GTEGTAPPLDTEISEKNMLNVIEIV
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaagttggatacacgtctgtgtccatttcctgctgttcattacgctt
ggggtgcattcagatagacttaacatcaacccagtgaccgatgacatcgctaaactctcc
actttgagacaaaatattcctaaagattacctaattcctctagagtacattcctaaagaa
gaggctgggatgtgttggatgaaattaaatatcttctacttggaggaaagcttagaacgg
ttatcagaaaagtttggaaacgtttcatccaataaagagaacattagcatattcatccag
atactccaagaacaacgggtccatatgcaggatctgaatgacatcatgcttgattttgag
tgccactatagggaagagaggtttgacaccaaccaatactttgacttcatcgaagattta
ctcagagctgtagagaataaagaagatgcacatgactgtgatgttcctccctgtcccacc
tcaccattaacagaaaagtattcagaagagtcccccactcccaccagtaatgccccactg
tgtccaaatgactgcaaaacaagtcagcaacaaagactcctgcctgaggtggtggagaga
agccttctctccttactcttcattccacttttagccatcgtgttcttgctcgtatggaag
gtcagatcacggaggaaccaggacggtgttcaacagaatcctgcagaagaaggactcaca
ggaacagaagggactgcacctccactagatactgaaatatcagaaaagaacatgctgaac
gtcattgaaatagtgtaa

DBGET integrated database retrieval system