KEGG   Oreochromis niloticus (Nile tilapia): 100698501
Entry
100698501         CDS       T06104                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X2
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04012  ErbB signaling pathway
onl04068  FoxO signaling pathway
onl04110  Cell cycle
onl04115  p53 signaling pathway
onl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100698501
   04068 FoxO signaling pathway
    100698501
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100698501
   04115 p53 signaling pathway
    100698501
   04218 Cellular senescence
    100698501
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100698501
NCBI-ProteinID: XP_003450744
Ensembl: ENSONIG00000016725
UniProt: I3KIX2
LinkDB
AA seq 181 aa
MAMASKSIAESAMESDSELSRLGGIEAWKLKAGPVRKNLFGPVDHQQLQQDFQRLFCMSV
EVANKRWNFDFQSDVPLEDSNIQWEALRCQDVPAFYRSCTVRPLARSGAEKTRERRRTSS
LSGEGSPESSASSGSGDEYLEVTTRGCYRIQRTGKRRQAAITDFFKVKKRRLLHNKASSR
Q
NT seq 546 nt   +upstreamnt  +downstreamnt
atggcaatggcctctaaatcaatagcggaatcagctatggagtccgactcagagctttcg
cgcctgggaggcatcgaggcctggaagttgaaggcggggccggtgcggaagaacctcttc
gggcccgtggatcaccagcagctgcagcaggacttccagcgactgttctgcatgagcgtg
gaggtggccaacaagcgctggaactttgacttccagagcgacgtgccattagaggactcc
aacatccaatgggaggcgctcaggtgtcaggatgtgccggcgttttaccgcagctgcacg
gtgcggccactggcgaggtctggagctgagaagacaagggagaggcggcggacgtcgtct
ttgtcgggcgagggttcgcctgagtcgagcgcctcgtctgggtctggggacgagtaccta
gaagtaaccactagggggtgctaccggatccagcgaacggggaaacgcagacaggctgcg
atcacagatttcttcaaggtaaagaagaggaggctcctgcataacaaggcttcctctcgg
cagtag

DBGET integrated database retrieval system