KEGG   Oreochromis niloticus (Nile tilapia): 100698573Help
Entry
100698573         CDS       T06104                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00590  Arachidonic acid metabolism
onl01100  Metabolic pathways
onl04370  VEGF signaling pathway
onl04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100698573 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100698573 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100698573 (ptgs2)
Enzymes [BR:onl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100698573 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 100698573
NCBI-ProteinID: XP_003445100
Ensembl: ENSONIG00000010015
UniProt: I3JUQ0
LinkDB All DBs
AA seq 617 aa AA seqDB search
MKQKRSLRSMNKLTLLFFLLALCFLVGETVNPCCSEPCQNRGVCSPLGSEEYECDCTRTG
YYGQNCTTPEFFTWIKVSLKPTPNTVHYILTHFKGFWNIVNSISFLRDVIMRYVLTSRSH
LIDSPPTYNADYGYKSWEAYSNLSYYTRSLPPVPQDCPTPMGVVGKKELPDVKVLAEKLL
MRRQFIPDPQGTSLMFAFFAQHFTHQFFKSDMKRGPAFTVAKGHGVDLNHIYGDNLEKQH
KLRLFKDGKLKYQMLDGEMYPPTVKEVGVEMHYPPHVPDSHRFAVGHEAFGLVPGLMMYA
TIWLREHNRVCDVLKEVHPYWDDERLFQTARLILIGETIKIVIEDYVQHLSGYHFKLKFD
PELLFNQRFQYQNRIASEFNTLYHWHPLMPDSFHIEETDYSYKQFVFNTSVVTEHGISNL
VESFTNQIAGRVAGGRNVPGPILYVAIKSIENSRQMRYQSLNAYRKRFSMKPYTSFEDLT
GEKEMAAVLEELYGDVDAVELYPGLLVEKPRPNGIFGETMVEMGAPFSLKGLMGNPICSP
EYWKPSTFGGTVGFDMVNTASLQKLVCNNVQGPCPVASFHVPDVKETGPMIINSSTSQSR
GSDINPTIILKERTTEL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaagcggagtcttcggagcatgaacaaactcactttgctgtttttcctgttg
gccctgtgctttcttgtcggcgaaactgttaacccatgttgctcagagccatgccagaac
aggggtgtctgctcaccactgggctcagaagaatacgagtgtgactgcacacgcacgggg
tactatgggcaaaactgcacaacacctgaattcttcacctggatcaaagtgtctctgaag
ccaacacccaacacagtccactacatcctgacccacttcaagggtttctggaacatcgtc
aacagcatctcattcctcagggatgtcatcatgagatatgtgctgacatcccgatcccac
ttgattgacagtcctccaacttataatgctgattacggctataagagctgggaagcctac
tccaacctttcctactatacacgctccctcccccctgtgccgcaggattgcccaacccct
atgggagtagtaggcaaaaaggagctacctgatgttaaagttctggctgagaagctctta
atgaggagacagtttataccagacccgcagggcaccagtttgatgtttgccttcttcgca
cagcacttcacccaccagttcttcaaatctgacatgaagagagggcctgctttcactgtt
gctaagggtcatggggtggacctcaaccacatctacggtgacaacctggagaagcagcac
aagctgagactctttaaggatggcaagctgaaatatcagatgcttgatggagagatgtac
cccccgacagttaaggaagtgggtgtcgagatgcattacccccctcacgtcccagattct
caccgcttcgctgtcggccacgaggcattcggcctggtccctggtctgatgatgtacgcc
accatctggctccgcgaacacaaccgtgtgtgcgatgtgctgaaagaggtccacccatac
tgggatgacgaaagactcttccagaccgcacggctcatcctaatcggtgagaccatcaaa
atcgtgattgaggactacgtgcagcatctcagtggctatcacttcaaactgaagtttgac
cctgagctgctctttaaccagcgcttccagtaccagaaccgcattgcatccgagttcaac
accctttatcactggcaccctctgatgcctgatagtttccacattgaggagacagattac
agctacaagcagtttgtcttcaacacctctgtcgtgactgagcacggcatcagcaacctg
gtggagtcgttcaccaatcagattgccggacgggttgctggtggtcgaaatgtccccgga
cccatcttgtatgtggccattaagtccatagagaacagcagacaaatgcgttaccagtcc
cttaacgcctacaggaaacgattctccatgaagccctacacgtctttcgaagacctgaca
ggggagaaagaaatggctgcggtgctggaggagctgtacggggacgtcgatgctgtggag
ctctacccgggcctgctggtggagaagcccagacctaacggcatctttggggaaacaatg
gtggagatgggggctcctttctccctcaagggcctaatgggaaatcccatctgctccccg
gagtactggaagcccagcaccttcggaggcacagtcggcttcgacatggtcaacaccgcc
tcgctccagaagctggtgtgcaataacgtgcagggtccctgccccgtggcgtcctttcat
gtgcctgacgttaaagagaccgggcccatgatcatcaactcaagcacgtcgcagtcgagg
ggcagcgacatcaaccccaccatcattttgaaagaaaggactactgagctctaa

DBGET integrated database retrieval system