KEGG   Oreochromis niloticus (Nile tilapia): 100702814
Entry
100702814         CDS       T06104                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
onl  Oreochromis niloticus (Nile tilapia)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 100702814
NCBI-ProteinID: XP_013128734
Ensembl: ENSONIG00000003972
UniProt: I3J814
LinkDB
AA seq 365 aa
MSWEEFIELRDLRSTKEQIELTGTRAPCSPPRLERTNALRISPGRVPDLLSRAGIIRVLS
SSQDPQLTEEKGEGHDFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCKFTCHYRCRALI
RLDCSWERGSLADPTCVVEHTIETDTNVDEQIECSKQELTVVDVQQKVKEYNAQINSNLF
MNMNKDGSYTGFIKVQFKLARPVSVPTPKKGGNDTGGRRASGVKRRTSFYLPKDASKHLH
ISSRTSAREVIEALLKKFTVVDNPAKFALFERSERHDQVYVRKLSDTERPLRLRLCAGPN
EKVLSFVLKENETGEVNWHAFSMPELKNFLRILQREEEEHIKQIVQRYALARTKMQEALA
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcttgggaggagttcatcgagctccgtgacctcaggtcgaccaaagagcagatagag
ctgacgggaacgcgcgctccgtgctcacctccgcgcctggagagaaccaacgccctgagg
ataagtccgggaagggtcccggacctgctgagtcgtgcaggcattatcagagtcctgagc
agcagccaggacccacagctcacagaggagaaaggagagggccacgacttccaaccctgt
agccacgctcagcccacgtggtgcgacctgtgtggagactttatctggggcctttacaag
cagagcctgcggtgtgtcaattgtaaattcacatgtcactaccgatgccgtgccctgatt
cgactggactgcagctgggaacgaggctccttggctgaccccacatgtgtcgtggagcac
accatagaaacggacacaaatgtggatgaacagattgaatgtagtaagcaggagctgaca
gtggtggacgttcagcagaaagtgaaggagtacaacgctcagatcaacagcaatctgttc
atgaacatgaacaaggatgggtcctacactggcttcataaaggtgcagttcaagctggcc
cgacccgtgtctgttcccaccccaaagaaaggaggtaacgacacaggcgggaggcgggcc
agtggagtgaaacggcgcacctctttctacctgccgaaggacgcgtccaagcatttgcac
ataagttctcgaacttcggctcgtgaggtcatcgaggctttgttgaagaagttcaccgtt
gtggacaatcccgccaagttcgctctatttgagcgcagcgagcgtcacgaccaagtttat
gtccgtaagctttctgatactgagcgtcccctccgtctgcgtctgtgcgctggaccgaat
gagaaagtcctcagttttgtgctgaaagagaacgaaactggcgaagtcaattggcatgcc
ttctccatgcctgagttaaagaacttcctgcggattctgcagcgcgaagaggaggaacat
atcaagcagatcgtgcagcgctacgctttggctcgcactaaaatgcaggaggctctggct
ggctccacacccggctga

DBGET integrated database retrieval system