KEGG   Oreochromis niloticus (Nile tilapia): 100705378
Entry
100705378         CDS       T06104                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04141  Protein processing in endoplasmic reticulum
onl04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:onl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100705378
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100705378
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:onl03000]
    100705378
Transcription factors [BR:onl03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100705378
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf MCU DUF4140 FANCAA CENP-H
Other DBs
NCBI-GeneID: 100705378
NCBI-ProteinID: XP_005464376
Ensembl: ENSONIG00000005080
LinkDB
AA seq 712 aa
MSTDLLSDLDSRFFADNLLTSEDWDACLFQCESMEEGEDGDFGRGLKYDATFDNDLVLTL
DPDNPTSPWRHLDDNLLTADAPAIKNEMTITQPLPVEMLFQVKAEPPSPPSSLESECSAS
PPDPQITIKGENPPTPPYMYGDVLSPPLGSMEVTIATTAPPTQTQIAAVTQTQLQTPLTT
PIPAVIGGLQTQAAVLPSSATLKANTILSTKPPIQPRPVCVATLPVTQTATPAKALILQG
LPSMDQTRPVVISPSVCLGSTPAIVKMEPVSPSIPQHCSSPTAPPASKPIVPATTTLPGN
SSNDIDMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRKENQALRE
RLAGKEGADSASNKRAVCVMVVLLFMTFSFGPVSITDRKLATGLQEDMVSFTGRRLLEIE
QRQQEAAPSTNKVEDKTETEEDVGDERWKRAEEKYAAESYQFRNLSDVFSDVKDLVLQDI
DRYFTSSDCRQFNRSESLRLADELRGWVHRHQIDRKKSGKPKIAKKAKIAQKAQQRKTNF
SRYLPIQTHRSIESQLQVLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKT
SRPKMSLVMPAMSVNESLYNSSQGYEMMMQVDCEVMDTRIVPIKSSAVPPPSEXPTPPPP
SSHSSSNHHHSNHTSLRGRHQHHPSSSSSSHRQPLPARRRTDEYLISQSEGV
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgagtacggatctgttgtcggatttggacagccgcttcttcgcggataacctgctgacg
agcgaagactgggatgcctgcctgttccagtgtgagagcatggaggagggcgaggacggg
gacttcggccgaggcttgaaatacgacgcaacgtttgacaatgacctcgtgctcaccctc
gatcctgacaaccctacgtcgccctggcgacaccttgacgacaaccttctcacagctgac
gctccggcgattaaaaatgaaatgacaataacgcagccgctgccggtggagatgttgttt
caggtgaaagcagagcctccctcgcctccgtcctcgctcgagtccgagtgctcggcctct
ccacctgacccacagatcaccattaaaggcgaaaatcctccgactcctccctacatgtac
ggagacgtgctgtcccctcccctggggtccatggaggttaccatagcaacaacagcaccc
ccaacacagacccagattgctgcagtgacacagacgcagctccagacgccgctgacgaca
ccgatcccggcggtcatcggcgggttacagacgcaggctgcagtcttgccgagctcggcc
acattaaaggccaacaccatcctgagcaccaaaccccccatccagccccgacccgtgtgc
gtcgccaccctccccgtcacccagactgccacgccggccaaggcgctcatactgcagggc
ctcccctccatggatcagaccagacctgtcgtcatctctccgtccgtctgcctcggctcc
acgccggccatcgtcaaaatggagcccgtctctcccagcatcccccagcactgctccagc
cccacggccccgcccgccagcaaacccatcgtcccggcgactacaactttgcccggcaac
agctcgaacgacatcgatatgaaagtgctgaagcggcagcagaggatgataaagaaccgt
gagtcagcctgccagtcgaggaagaagaagaaggagtacctgcagaacctggaggctcag
ctgagggaggcccagcaggagaacgaacggctccgcaaggagaaccaggcactgagggag
agactggcagggaaggagggcgccgactcagcgagtaacaagagagccgtgtgcgtcatg
gtcgtcctcctcttcatgaccttcagcttcggacccgtcagcatcacagacaggaagctg
gcgacgggtctgcaggaagacatggtgtcgtttacaggacggcggctgctggagatcgaa
cagcgtcagcaggaggcggcgccgtctaccaacaaggtggaggacaagactgagacggag
gaggacgtaggagacgaacgatggaagagagcggaggagaaatacgccgcagagtcgtat
cagttcagaaacctgagcgacgtgttcagtgacgtgaaggacctggttctgcaggacatc
gaccgatacttcacctcctcggactgccggcagttcaaccgctccgagtctctcaggctg
gcagacgagctgagaggatgggtccatcgacaccagatcgatcgcaagaagtccggaaaa
ccgaagatcgccaagaaggccaagatcgcccagaaagctcagcagaggaaaaccaacttc
tccagatatctgccgatccagactcaccgctccatagaaagtcagctgcaggtgcttcct
ggtcctgaggtcacctacagcgacttcctggacgccatcgaccgcagagaggacacgttc
tacgtggtctcgttcagacgggaccacctcctgcttccggccatcagccacaacaaaacc
agccggcccaagatgtccctggtgatgccggccatgtctgtaaacgagagcctctataac
tcgtctcagggctacgagatgatgatgcaggtcgactgcgaggtcatggacactcggatc
gtccccatcaagtcgtccgctgtcccccctccctccgagnnacccaccccgcctccccca
tcctcccacagcagctccaaccatcaccacagcaaccacacctcgctccgaggacgccac
cagcaccacccctcctcttcctcttcgtctcataggcagcctttacccgcccgccgacgg
acagatgaatacttaatcagccaatcagaaggagtttga

DBGET integrated database retrieval system