KEGG   Oreochromis niloticus (Nile tilapia): 100706829
Entry
100706829         CDS       T06104                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
onl04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100706829 (tgfa)
   04012 ErbB signaling pathway
    100706829 (tgfa)
SSDB
Motif
Pfam: EGF Laminin_EGF V_ATPase_I DUF4533
Other DBs
NCBI-GeneID: 100706829
NCBI-ProteinID: XP_025763381
Ensembl: ENSONIG00000004234
LinkDB
AA seq 255 aa
MMTRIFWETILLISGSLFTFGAGHSSSVTIEANISISINSTAPPDASSSSSATTSSRSTS
TTIPTTTNIPTVKSSLFIVGPRQTNATITDATISINATSSAAANTSASSSSTNTSSSATK
SLTGTTTTNIHPVKKFVAAAVRSHFDDCPDSHRHFCFHGTCRFLILEETPACVCHPGFIG
MRCEHADLLAVVATNHRQQTIATVLVLCVIGCVLIMVLCTVLHCWWRQDCRRRSHAHHYV
TEKHGVSCCPSESVV
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatgacccggattttctgggaaacaattttactcattagcggctctctctttaccttc
ggagcagggcacagcagttcagtaactattgaagccaatatttccatcagtataaactcc
actgctcctccagatgcctccagtagcagctctgcaacaaccagcagcagaagcacaagt
acaacaattccaaccacaaccaacatccctacagttaaaagttctctctttatagtcgga
ccaaggcagacaaatgcaacaattactgatgccaccatttctattaatgccacctcctct
gctgctgctaacacctcagcaagcagctcttcaacaaacaccagcagcagcgcaaccaaa
agcctcactggaaccactactaccaacatccaccctgttaaaaagtttgtagcagcagca
gttcggtctcatttcgatgactgtccagactcccaccgacacttctgcttccacggcacg
tgccgcttccttatactggaagagacacccgcatgtgtgtgtcatccaggctttatcggg
atgaggtgtgagcatgcagacctcctggctgtagttgcaaccaatcacaggcaacagacc
attgccacagtgctggtgttgtgtgtgattgggtgtgttctcatcatggtgttatgtaca
gtcttacactgctggtggagacaggactgtcgcaggcggagccacgcacatcactatgtt
acagaaaagcacggcgtgtcctgctgtccatctgagagtgtggtctga

DBGET integrated database retrieval system