Oreochromis niloticus (Nile tilapia): 100708306 Help Entry 100708306         CDS       T06104                                  Symbol elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:onl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100708306 (elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:onl04121]     100708306 (elob)    03400 DNA repair and recombination proteins [BR:onl03400]     100708306 (elob) Ubiquitin system [BR:onl04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      100708306 (elob)    Cul5 complex      100708306 (elob) DNA repair and recombination proteins [BR:onl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      100708306 (elob) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  100708306 NCBI-ProteinID:  XP_003458786 Ensembl:  ENSONIG00000011524 UniProt:  A0A669BC51 LinkDB All DBs Position LG8:16349020..16357485 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQLLEDSKTLGDS GFTNQTARPQAPATVGLAFRINDEMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagaccacaatcttcaccgatgccaaggag tccactactgtctatgagctgaagcgtattgtcgagggaatacttaaaagaccacccgag gaccaacgactctacaaagatgatcagctgctagaggatagcaaaactctgggtgactct ggattcaccaaccagactgccagacctcaagccccagctacagtcggtctggcatttcgt attaatgatgagatgtttgagcagctgcacatcgaggccttttccagccccccggaactc cctgatgtgatgaagcctcaggactctggtagcactgctaatgaacaggcagtgcagtga

DBGET integrated database retrieval system