KEGG   Oreochromis niloticus (Nile tilapia): 100710007
Entry
100710007         CDS       T06104                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00230  Purine metabolism
onl01100  Metabolic pathways
onl04020  Calcium signaling pathway
onl04114  Oocyte meiosis
onl04261  Adrenergic signaling in cardiomyocytes
onl04270  Vascular smooth muscle contraction
onl04371  Apelin signaling pathway
onl04540  Gap junction
onl04912  GnRH signaling pathway
onl04914  Progesterone-mediated oocyte maturation
onl04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100710007
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100710007
   04020 Calcium signaling pathway
    100710007
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100710007
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100710007
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100710007
   04914 Progesterone-mediated oocyte maturation
    100710007
   04916 Melanogenesis
    100710007
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100710007
   04270 Vascular smooth muscle contraction
    100710007
Enzymes [BR:onl01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100710007
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053 OPA3
Other DBs
NCBI-GeneID: 100710007
NCBI-ProteinID: XP_003454904
Ensembl: ENSONIG00000016520
LinkDB
AA seq 1121 aa
MPRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRTSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYIILMCAVVYTADKLASVLVASVGLAADII
LYLLCRFGLLPDRISRRVLPYALWVLIAAQIFCYLGLNYARFHQASDTVGWQAFFSFSVF
LTLPLRLTPIVLITTVSCGVHTLVLGVTIAQQQQDDIHGAALGRQLLANLVIYVCAITVG
IMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKGPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYRDDHAACSIMMGLAMVEAISYVREKTQTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFDVEPGNGGDRCD
YLRERGIDTYLVVVPKAPLGKNGINSVKLSVTSSNGNSPLLINTTDCNGSVHTACTTPEE
PEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQALKGKH
TNKLSLRFVDPELETRFSVEKEKQSGAAFCCSCVVLLFTAVMEALIDPWLIANYITFAVG
EVLLLILTICSLAAIFPRVFAKKLVSFSTWIDHTRWARNTWAMTAIFILTMADIMDMLSC
LPQVPDSDTTTVAPSSSLSTVSSLEGCLNNPKYYSYVAVLALMATTMLVQVSHMVKLTLM
LLITVATGIVNIYSWKDIFDRYDMARFHDYRSFLVPSKFAMTVMIFIMMVSFYYFSRHVE
KLARTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDE
IGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPQFRCITKIKTIGSTY
MAASGVTPDVSNGYNSIKKEELSDTERWQHLADLADFALAMKVTLMNINYQSFNNFMLRI
GLNKGGVLAGVIGARKPHFDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYGFRFVR
RGPIFVKGKGELLTYFLKGRDKQGSFINGSSVTLPHQVVDS
NT seq 3366 nt   +upstreamnt  +downstreamnt
atgcctcggaaccgagccttttctgagcccgagtattccgctgagtattcagcagactgc
tctgtgacgttgccctctgaccccgggcaggcagtgggacgaacacacgaggtcacggtg
cggacctcgggatgctgcctctgtctgccacgtttcatgcgcctgacctttgcgcccgag
tccttggagaatctttatcagacctactttagacggcagagacacgaaaccctgctggtg
ctcgtcgtgtttgccgcgctgttcgacagctacatcatcctcatgtgtgctgtggtctac
accgctgataagctggcttctgttttagtggcatcagtgggactggcagcagatatcatt
ctctatctgctgtgccgcttcgggctgctgccagaccgcatctccaggcgggtgttgccc
tatgccctgtgggtgctcatagcagctcagatattctgctacctgggtttgaattatgct
cgcttccaccaggccagcgacactgtaggctggcaggctttcttcagtttctcggttttt
ctgactctgcctttgagactgactcccattgtgctcatcaccactgtgtcctgtggggtc
cataccctggttctgggtgtcaccattgcccagcagcagcaggatgacatacatggcgca
gctcttggcagacagcttctagccaaccttgtgatttatgtttgtgccatcactgtgggc
atcatgtcgtactacatggccgatcggaaacatcggaaggcctttctggaggcgagacag
tcactggaggtcaaactcaacctggaggagcagagtcaacaacaggagcgtctgctcctc
tccattcttccaaagcacatagctgatgaaatgcttcaggacatgaagaagggacctagt
cagaaagaaatgcaacagttcaacaccatgtacatgtacaggcatgaaaatgtcagtatt
ttgtttgcagacattgtgggcttcacccagctgtcgtcttcttgcagtgctcaggagctt
gtcaaactgcttaatgagctctttgcccgctttgacaaactagctgctaaataccaccag
ctaaggatcaagatcctgggagactgctactactgtatttgtgggctgccggactacagg
gatgaccatgccgcctgctctatcatgatgggcctggccatggtggaggccatttcgtat
gtccgagagaaaacccagacagatgtcgacatgcgtgttggagtgcacagtggtacggtc
ctgggaggagtgctgggtcagaaacgttggcagtatgatgtttggtccacagatgtcaca
gtggccaataaaatggaggctggagggatcccaggccgagttcacatctcacaaagcacc
atggagtgtcttcatggtgagtttgatgtggagccggggaatggaggtgaccgctgtgac
tacctgagggagagaggcatagacacctacctggtggttgttccaaaagcacctttggga
aagaatggcattaacagtgtcaaactgtccgtaacctcgtccaatggaaattctcctctg
ctaatcaacaccacagactgtaatggcagtgtccacacagcctgcaccacaccagaggaa
ccagaggaactggacacaagggtggtgaacccatcgtttcctaatccccgaaggaggctg
aggctgcgggacctggctgaacgggtgattgatgctcaggagaacgaacaggagctcaac
aaactccttaatgaagctctgctggagagagagacggttcaagctctgaaggggaaacac
accaacaagctgtccctcaggtttgtggatccagagctggaaacacgtttctctgtggag
aaggaaaaacagagtggggctgccttctgctgctcctgtgtggttctgctctttactgca
gtgatggaggcgctcatagacccctggctgattgcaaactacatcacctttgcagtgggg
gaagtcttactgctcatcctgaccatttgttctttggctgccatcttccccagagtcttt
gccaaaaagctggtgtctttctccacctggattgaccacacacgttgggctcgcaacact
tgggccatgactgccattttcatcctaaccatggctgacataatggacatgcttagttgt
ctgcctcaggtcccagactcagacaccaccacagtggctccctcctcctcgttgtccacc
gtgtccagccttgaaggctgcctgaacaatcccaaatattacagctacgttgctgtgctg
gcactgatggccaccacaatgctggttcaggtcagtcacatggttaagcttaccctgatg
ctgctcatcacagtggccaccggcatcgttaacatctacagctggaaggacatctttgac
cgctatgacatggcccgcttccacgactacaggtcatttctggtcccatctaaattcgca
atgacagttatgatcttcattatgatggttagcttctattacttctccagacatgtggag
aagcttgcccgtacccttttcctctggaagattgaagttcatgaacaaaaggagaaggtg
tatgagatgcggcgctggaacgaagcactggtgaccaacatgctgcctgaacatgtggct
cgacacttcctaggatccaagaaaagggacgaggaactgtacagccagtcatatgacgag
attggagtcatgtttgcttctatccccaacttttctgacttttacacagaggagagcatc
aataacggaggcattgaatgcttacgctttctcaacgagatcatctcagactttgacagt
ctgcttgatgagcctcagtttcgctgcattacaaaaatcaagactattggcagcacatac
atggcagcgtcaggtgtcaccccggacgtcagcaacggttacaactccatcaagaaggaa
gagctgtcggacacggagcgctggcagcacctggcagaccttgcagactttgcgctggcc
atgaaggttacacttatgaacatcaactaccaatcattcaacaatttcatgctgcgcatc
ggtctaaataagggaggggtgctagctggagtgattggtgctcgcaaaccccactttgac
atctggggcaacactgtaaatgtggcaagccgcatggagtccacaggtgtgatgggcaac
atccaggtagtggaggactgctacaacatcctgaaggagtatggttttcgctttgtgagg
agagggcccatctttgtgaaggggaaaggagagctgctcacttattttctgaagggaaga
gacaaacaaggctcatttatcaatggctcctctgtcactctgccacatcaggtggtggat
agttga

DBGET integrated database retrieval system