KEGG   Orcinus orca (killer whale): 101273294
Entry
101273294         CDS       T05247                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor04068  FoxO signaling pathway
oor04110  Cell cycle
oor04115  p53 signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04218  Cellular senescence
oor04310  Wnt signaling pathway
oor04340  Hedgehog signaling pathway
oor04371  Apelin signaling pathway
oor04390  Hippo signaling pathway
oor04510  Focal adhesion
oor04530  Tight junction
oor04630  JAK-STAT signaling pathway
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04934  Cushing syndrome
oor05160  Hepatitis C
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05169  Epstein-Barr virus infection
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05216  Thyroid cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05222  Small cell lung cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101273294 (CCND1)
   04340 Hedgehog signaling pathway
    101273294 (CCND1)
   04390 Hippo signaling pathway
    101273294 (CCND1)
   04371 Apelin signaling pathway
    101273294 (CCND1)
   04630 JAK-STAT signaling pathway
    101273294 (CCND1)
   04068 FoxO signaling pathway
    101273294 (CCND1)
   04151 PI3K-Akt signaling pathway
    101273294 (CCND1)
   04152 AMPK signaling pathway
    101273294 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101273294 (CCND1)
   04115 p53 signaling pathway
    101273294 (CCND1)
   04218 Cellular senescence
    101273294 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101273294 (CCND1)
   04530 Tight junction
    101273294 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101273294 (CCND1)
   04921 Oxytocin signaling pathway
    101273294 (CCND1)
   04919 Thyroid hormone signaling pathway
    101273294 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101273294 (CCND1)
   05206 MicroRNAs in cancer
    101273294 (CCND1)
   05205 Proteoglycans in cancer
    101273294 (CCND1)
   05203 Viral carcinogenesis
    101273294 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101273294 (CCND1)
   05212 Pancreatic cancer
    101273294 (CCND1)
   05225 Hepatocellular carcinoma
    101273294 (CCND1)
   05226 Gastric cancer
    101273294 (CCND1)
   05214 Glioma
    101273294 (CCND1)
   05216 Thyroid cancer
    101273294 (CCND1)
   05221 Acute myeloid leukemia
    101273294 (CCND1)
   05220 Chronic myeloid leukemia
    101273294 (CCND1)
   05218 Melanoma
    101273294 (CCND1)
   05219 Bladder cancer
    101273294 (CCND1)
   05215 Prostate cancer
    101273294 (CCND1)
   05213 Endometrial cancer
    101273294 (CCND1)
   05224 Breast cancer
    101273294 (CCND1)
   05222 Small cell lung cancer
    101273294 (CCND1)
   05223 Non-small cell lung cancer
    101273294 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101273294 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101273294 (CCND1)
   04934 Cushing syndrome
    101273294 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101273294 (CCND1)
   05162 Measles
    101273294 (CCND1)
   05160 Hepatitis C
    101273294 (CCND1)
   05163 Human cytomegalovirus infection
    101273294 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101273294 (CCND1)
   05169 Epstein-Barr virus infection
    101273294 (CCND1)
   05165 Human papillomavirus infection
    101273294 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101273294 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101273294
NCBI-ProteinID: XP_004278095
LinkDB
Position
Unknown
AA seq 295 aa
MAHQLLCCEMETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELVLVNKLKWNLAATTPHDFIEHFLSKMPVVEESKQVIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSANSFLSYHRLTRFLSKVIRCD
PDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEGEEEDEADLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgagatggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgta
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtcgcctcgaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctatactgacaactccatccggcccgacgagctgctgcaaatg
gagctggttttggtgaacaaactcaagtggaacttggctgccacgaccccgcacgacttc
attgaacacttcctctccaaaatgccggtggtcgaggagagcaaacaggtcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaacccgccc
tccatggtggctgccgggagcgtggtggccgcggtgcaaggcctgcacctgggaagcgcc
aacagcttcctgtcctatcaccgcctgacgcggttcctctccaaagtgatcaggtgtgac
ccggactgcctccgcgcctgccaggagcagatcgaggccctcttggagtccagcctgcgc
caggcccagcagcagaacttggaccccaaggccgcggaggagggggaggaggaggacgag
gcggacctggcctgcacgcccaccgacgtgcgcgacgtggacatttga

DBGET integrated database retrieval system