KEGG   Orcinus orca (killer whale): 101274585Help
Entry
101274585         CDS       T05247                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1 isoform X1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00590  Arachidonic acid metabolism
oor01100  Metabolic pathways
oor04611  Platelet activation
oor04726  Serotonergic synapse
oor04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101274585 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101274585 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101274585 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    101274585 (PTGS1)
Enzymes [BR:oor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101274585 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 101274585
NCBI-ProteinID: XP_004269299
LinkDB All DBs
Position
Unknown
AA seq 600 aa AA seqDB search
MSRRSVSLRFPLLLLLLPPSPVLPAAPGAPAPVNPCCYYPCQHQGICVRFGFDRYQCDCT
RTGYSGPNCTIPELWTWLRTTLRPSPSFLHFLLTHGRWFWEFVNATYIRDMLMRLVLIAR
SNLIPSPPTYNAAHDYISWESFSNVSYYTRVLPSVPQDCPTPMGTKGKKQLPDAELLSRH
FLLRRKFIPDPQGSNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYHLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLML
YATLWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLLGTHFQYRNRIAMEFNHLYHWHPLMPDSFRVGPQNYSYEQFLFNTSMLVDYGVE
ALVDAFSRQPAGQIGGGRNTDHHVLYVAVEVIKESRELRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAADLEELYGDIDALEFYPGLLLEKCSPNSIFGESMIEIGAPFSLKGLLGNPIC
SPEYWKSSTFGGEMGFNLVKTATLRKLVCLNTKTCPYVSFHVPDPRQEDGPGVGRPSTEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcggagtgtctcgcttcggttcccgctgcttctgctgctgctgccgccatcc
cccgtcctgccagcggcccccggggcacccgcgccggtgaacccctgttgttactatcca
tgccagcaccagggtatctgtgtccgcttcggctttgaccgctaccagtgcgactgcacc
cgcacgggctattccggccccaactgcaccatccctgagctatggacctggctccggact
actttgcggcccagcccctctttcctccacttcctgctgacgcatggccgctggttctgg
gagtttgtcaatgccacctacatccgggacatgctcatgcgtctggtactcatagcgcgt
tccaacctcatccccagcccccccacctacaatgcagcgcatgactacatcagctgggaa
tccttctccaacgtgagctactatacgcgtgttctgccctctgtgccccaagactgtccc
acgcccatggggaccaaagggaagaagcagttgcccgacgccgagctcctgagccgtcac
ttcctgcttaggaggaagttcatccctgacccccaaggcagcaacctcatgtttgccttc
tttgcgcaacacttcacacatcagttcttcaaaacttctggcaagatgggtcctggcttc
accaaggctttgggccatggggtcgaccttggccacatttatggagacaatctggaacgt
cagtatcacctgcggctctttaaggatgggaaactcaagtaccaggtgctggacggagag
atgtacccgccatcggtggaagaggcgcccgtgctgatgcactacccccggggcatcccg
ccccagagccagatggcagtgggccaggaggtgttcgggctgcttccggggctcatgctc
tatgccacactctggttgcgtgagcacaaccgagtgtgtgacctgctgaaggctgagcac
cccacctggggcgatgagcagctcttccagacggcccgcctcatcctcatcggggagacc
atcaagattgtgatcgaggagtacgtgcagcagctgagtggctacttcctgcagctcaag
tttgacccagagctgctgttaggcacccacttccagtaccgtaaccgaattgccatggag
ttcaatcacctctaccactggcacccgctcatgcccgactccttccgggtgggcccccag
aactacagctatgagcagttcctgttcaacacctccatgctggtggactacggggtcgag
gccctggtggacgccttctctcgccagcccgcgggccagatcggcgggggtaggaacaca
gaccaccatgtcctatacgtggctgtggaagtcatcaaggaatcgagagagttgcggctg
cagcccttcaatgagtaccgcaagaggtttggcatgaagccctacacctctttccaggag
ctcacaggagagaaggagatggccgctgacttggaggagctgtatggggacatcgatgcc
ttggagttctacccagggctgctgcttgagaagtgctctccaaactccatctttggggag
agtatgatagaaattggggctcctttttcccttaagggcctcttagggaatcctatctgt
tctccagagtactggaaatcgagcacatttggcggtgagatgggtttcaaccttgtcaag
acggccacgctgaggaagctggtttgcctcaacaccaagacttgtccctacgtctccttc
cacgtgccggacccccgccaggaggacgggcctggagtggggcggccatccacagagctc
tga

DBGET integrated database retrieval system