KEGG   Orcinus orca (killer whale): 101275475
Entry
101275475         CDS       T05247                                 

Gene name
FN1
Definition
(RefSeq) fibronectin isoform X1
  KO
K05717  fibronectin 1
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04151  PI3K-Akt signaling pathway
oor04510  Focal adhesion
oor04512  ECM-receptor interaction
oor04810  Regulation of actin cytoskeleton
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor05100  Bacterial invasion of epithelial cells
oor05135  Yersinia infection
oor05146  Amoebiasis
oor05165  Human papillomavirus infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101275475 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101275475 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101275475 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101275475 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101275475 (FN1)
   05205 Proteoglycans in cancer
    101275475 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101275475 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101275475 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101275475 (FN1)
   05100 Bacterial invasion of epithelial cells
    101275475 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101275475 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101275475 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101275475 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oor04147]
    101275475 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:oor00536]
    101275475 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:oor04990]
    101275475 (FN1)
Membrane trafficking [BR:oor04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    101275475 (FN1)
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   101275475 (FN1)
Glycosaminoglycan binding proteins [BR:oor00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   101275475 (FN1)
Domain-containing proteins not elsewhere classified [BR:oor04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   101275475 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 DUF1410
Other DBs
NCBI-GeneID: 101275475
NCBI-ProteinID: XP_004262794
LinkDB
Position
Unknown
AA seq 2478 aa
MLGDPGPRLLLLLTVLFLGTAVPSTGASKSKRQAQQVVQPQSPLAVSQSKPGCYDNGKHY
QINQQWERTYLGSALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTS
YRIGDTWRKKDNRGNLLQCICTGNGRGEWKCERHTTLQTTSAGSGSFTDVRTAIYQPQPH
PQPAPYGHCVTDSGVVYSVGMQWLKAQGNKQMLCTCLGNGVSCQETAITQTYGGNSNGEP
CVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGAL
CHFPFLYNNQNYTDCTSEGRRDNMKWCGTTRNYDADQKFGFCPMAAHEEICTTNEGIMYR
IGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDDITYNVNDTFHKRHEEGH
MLNCTCFGQGRGRWKCDPIDQCQDSESRTFYQIGESWEKFLHGVRYQCYCYGRGIGEWGC
QPIQTYPGSTGPVQVIITETPSQPNSHPIQWNAPEPSHISKYILRWKPKNSPDRWKEATI
PGHLNSYTIKGLRPGVVYEGQLISVQHYGQREMTRFDFTTTSTSPVVTSNTVTGETTPFS
PVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPD
LLPGRKYIVNVYQISEEGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPIT
GYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETT
GVPRSDKVPPPRDLQFVEVTDVKITIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPTSRN
TFAEVTGLSPGVTYHFKVFAVNHGRESKPLTAQQATKLDAPTNLQFINETDTTIIVTWTP
PRARIAGYRLTVGLTRGGQPKQYNVGPSSTQYPLRNLQPGSEYSATLVAVKGSQQSPRAT
GVFTTLQPLGSIPPYHTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSESGSIV
VSGLTPGVEYIYTISVLKDGQERDTPIVKKVVTPLSPPKNLHLETNPDTGVLTVSWERSS
TPDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKDDKESVPI
SDTIMPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSS
VGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTMRVTWA
PPPSIELTNLLVRYSPVKNEEDVAELSVSPSDNAVFLTNLLPGTEYLVSVSSVYEQHESV
PLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYKIRHHPEHMSGRPREDRVPP
SRNSITLTNLNPGTDYVVSIVALNGKEESPSLVGQQTTVSDVPRDLEVIAATPTSLLISW
DAPAVTVRYYRITYGETGGSSPVQEFTVPGSKSTATISGLKPGADYTITVYAVTGRGDSP
ASSKPISIDYRTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTTPKNGPGPSKTM
TAGPDQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSI
KIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEETAELQGLRPGSEYTVSVVALHDD
MESQPLIGTQSTAIPAPTNLKFTQVSPTSLAAQWTAPNVQLTGYRVRVTPKEKTGPMKEI
NLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATET
TITISWRTKTETITGFQVDAIPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIHLYTLND
NARSSPVVIDASTAIDAPSNLHFLATTPNSLLLSWQPPRARITGYIIKYEKPGSPPREVV
PRPRPGVTEATITGLEPGIEYTIQVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGP
EILDVPSTVQKTPFITNPGYDTGNGIQLPGTSGQQPSLGQQMIFEEHGFRRTTPPTMASP
VRHRPRPYPPNVNEEIQIGPVPRGDVDHHLYPHVLGLNPNASTGQEALSQTTISWTPFQE
SSEYIISCHPVGIDEEPLQFRVPGTSASATLTGLTRGATYNIIVEAIKDQKRHKVREQVV
TVGNSVDQGLNQPTDDSCFDPYTVSHYAIGEEWERLSESGFKLSCQCLGFGSGHFRCDSS
KWCHDNGVNYKIGEKWDRQGESGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQW
QKEYLGAICSCTCFGGQRGWRCDNCRRPGAEPGHEGSTGHSYNQYSQRYHQRTNTNVNCP
IECFMPLDVQADREDSRE
NT seq 7437 nt   +upstreamnt  +downstreamnt
atgctcggggatccggggccccggttgctgctgctgctgaccgtcctgttcctggggaca
gcggtgccctccactggagcctcgaagagcaagaggcaggctcagcaggtcgttcagccc
cagtccccgttggctgtcagccaaagcaagcctggttgttatgacaatgggaaacactat
cagataaaccaacaatgggagcgcacctacctgggcagtgccttggtctgcacctgttat
ggagggagccggggctttaactgcgagagcaagcctgaacctgaagagacttgctttgac
aagtacaccgggaacacttaccgggtgggcgacacttacgagcgccctaaggactccatg
atctgggactgcacctgcattggggctgggcgagggagaataagctgcaccattgcaaac
cgctgccatgaagggggtcagtcctacaagattggtgacacctggaggagaccacacgag
actggtggttacatgttggagtgtgtgtgtctcggtaacgggaaaggagaatggacctgc
aaacccatagctgagaaatgttttgatcacgctgctgggacttcctacgttgtcggggag
acctgggaaaagccttatcaaggctggatgatggtggattgtacttgtctgggagaaggc
agtggacgcatcacctgtacctccaggaacagatgcaacgatcaggacactaggacatcc
tatagaattggggatacctggcgcaagaaggacaatcgggggaacttgctccaatgcatc
tgcactggcaacggccgtggcgagtggaagtgtgagaggcacacaaccctgcagaccacg
tctgccggatctggctccttcacagacgtccgaacggccatttaccagccacagcctcac
ccccagccggctccgtacggtcactgtgtcacagacagtggtgtggtttactccgtgggc
atgcagtggctgaaggcacaaggaaataagcaaatgctttgcacttgcctgggcaatgga
gtcagctgccaagagacagctataacccagacgtatggtggcaattcaaatggggagcct
tgcgtcctaccattcacctacaacggcaggactttctactcctgcaccacagaagggcga
caggatggacatctctggtgcagcacaacttccaattatgagcaagaccagaaatattct
ttctgtacagaccatactgtcttggttcaaactcgaggtggaaattccaatggtgccttg
tgccactttcccttcctgtacaacaaccaaaactacaccgactgtacatccgagggcagg
agggacaacatgaaatggtgtggaaccacacggaactatgacgctgaccagaagtttgga
ttctgccccatggctgcccacgaggaaatctgtacaaccaatgaagggatcatgtatcgc
attggagaccagtgggacaaacagcatgatatgggccacatgatgagatgcacatgtgtt
gggaacggtcgtggagaatggacatgtgtcgcctactcccagctccgagatcagtgcatc
gtcgacgacatcacatacaatgtgaatgacacattccacaaacgtcacgaagagggacac
atgctgaattgtacctgcttcggtcagggcaggggccggtggaagtgcgatcccattgat
caatgccaggattcagaatcccgtaccttttatcaaattggagaatcatgggagaagttt
ttgcatggagtcaggtaccagtgctattgctatggccgtggcattggggagtggggctgc
cagcccatacagacctatccaggttcaactggtcctgtccaagtaataatcactgagacc
cccagtcagcccaactctcaccccatccaatggaatgcaccagaaccatctcacatttcc
aagtacattctcagatggaaacctaaaaattctccagaccgttggaaggaagccaccatt
ccgggccacttaaactcctacaccatcaaaggcctgaggccaggtgtggtatacgagggc
cagctcatcagcgtccagcactacggccaaagagagatgacgcgcttcgacttcaccacc
accagcacaagcccagtggtgaccagcaacaccgtgacgggagagacaacacccttttct
cctgttgtggccacctccgaatccgtgactgaaatcacagccagcagcttcgtggtctcc
tgggtctcggcttcggacactgtgtccggattccgggtggagtatgagctgagtgaagag
ggagatgaacctcagtacctggatcttcccagcacagccacttctgtgaacatccctgac
ctgcttcctggccgaaaatacattgtgaacgtctatcagatatccgaagaaggagaacag
agtttgattctgtctacctcacagacaacagcacctgatgcccctcctgaccctaccgtg
gaccaggttgatgacacctcgattgtcgttcgctggagcagaccccaggcgcccatcaca
ggatacagaatcgtctattccccatcagtagagggtagtagcacagaactcaaccttcct
gaaactgccaactctgtcactctcagtgacttgcagcctggtgttcagtataacatcact
atctacgctgtggaagaaaatcaagagagtactcctgtcttcatccaacaagaaaccact
ggcgtcccacgttcagataaagttccccctcccagagacctgcagtttgtggaggtgacg
gacgtaaagatcaccatcatgtggacaccccccgagagcgcggtgaccggttaccgagtg
gacgtgatccccgtcaacctgcctggggaacacgggcagaggctgcccaccagcaggaac
acatttgcagaagtcactggcctgtcccctggggtcacctatcacttcaaagtcttcgcc
gtgaaccacgggagggagagcaagcctctgacggcacaacaggcgaccaaattggatgct
cccaccaacctccagtttatcaatgaaactgacaccaccatcatagtgacctggactcca
cctcgtgcccggatagccgggtaccgactgaccgtgggcctgacccgtggaggccagccc
aagcagtacaacgtaggtccctcgtccacgcagtatccactgaggaatctgcagcctggc
tctgagtactccgcaaccctcgtggccgtgaaaggcagccagcagagccccagagccact
ggagtcttcaccaccctgcagcctctgggctccatcccaccttaccacacagaagtgact
gaaaccaccattgtgattacatggacacctgctccaaggattggttttaagctgggtgta
cgaccaagccagggaggggaagcaccacgagaagtgacctcagagtcaggaagcatcgtt
gtgtctggcctgactccaggcgtggaatacatttacaccatctcagtcctgaaagacggg
caagagagagatacaccaattgtgaagaaagtggtgacaccactgtctccaccaaagaac
ttgcacctggaaacaaaccccgacactggcgtgcttactgtctcctgggagaggagttcc
accccagacattactggctatagaattaccaccacccctacaaatggccagcagggctat
tctttggaagaagtggtccatgccgatcagagttcctgcacttttgaaaacctgagtcct
ggcctggagtacaatgtcagtgtttacactgtcaaagatgacaaggaaagtgtccctatc
tctgataccatcatgccagaggtgccccagctcactgacctaagctttgttgatataacc
gattcaagcatcggcctgaggtggaccccgctaaactcttccaccattattgggtaccgc
atcacagtagttgcggcaggagaaggtatccctatttttgaagattttgtggactcctca
gtaggatactacacagttacagggctggagcctggcattgactatgacatcagcgttatc
actctcattaatggcggagagagtgcccctactacactgacacaacaaaccgctgtccct
cctcccactgacctgcgatttaccaatgttggtcccgacacgatgcgtgtcacctgggcc
ccacctccatccattgaattgaccaacttactggtgcgctactcgcctgtgaaaaatgag
gaggatgttgcagaattgtcagtttctccttcagacaatgcagtgttcttaacaaatctc
ctgcctggaacagagtatttagtcagcgtctccagtgtttacgagcagcatgagagcgta
cctcttagaggaagacagaaaactggtctcgattccccaactggcattgacttttctgat
atcactgccaactctttcactgtccattggattgctcctcgagctaccatcaccggctac
aagatccgccatcatcctgagcacatgagtggaagacctcgggaggatcgagtgcctccc
tctcggaattccatcacactcaccaatctcaatccgggcacagattatgtggtcagcatt
gtcgctcttaatggcaaagaggaaagtccttccttggttggccagcaaacgacagtttct
gatgttccaagggacctggaagtcatcgctgccacccccactagcctgttgatcagctgg
gatgctccggccgttacagtgagatattacaggatcacctatggagaaacaggaggaagt
agccctgtccaggagttcactgtgcctgggagcaagtctacagctaccatcagtggtctt
aaacctggagcagactacaccatcaccgtttatgctgtcactggccgtggggacagcccg
gcaagcagcaagcccatttccattgattaccgaacagaaattgacaaaccatcccagatg
caagtgactgatgtccaggacaacagcattagtgtcaggtggctgccttcaagttccccc
gttaccggttacagagtgaccactactcctaaaaatggcccaggaccatcgaaaacaatg
actgcaggtccagatcaaacagaaatgacaattgaaggcttgcagcccacagttgagtac
gtggttagtgtctacgctcagaatcgaaacggagagagtcagcctctggttcagacagca
gtaaccaacattgatcgccctaaaggactggcattcactgatgtggatgtcgattccatc
aaaattgcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagc
cctgaggatggaatccatgagctattccctgcacctgatggtgaagaagagactgcagag
ctgcaaggcctcaggccgggttctgagtacacagtcagtgtggttgccttgcacgatgat
atggagagccagcccctgattggaacccagtccacagccattcctgcaccaaccaacctg
aagttcactcaggtttcaccaaccagcctggccgcccagtggacggcacccaatgttcag
ctcactggatatcgagtgcgagtgacccctaaggagaagaccggaccaatgaaggaaatc
aaccttgctcccgatagctcatctgtggttgtatcaggactcatggtggccactaagtat
gaagtgagcgtctatgctctaaaggacactttgacaagcagaccagctcagggggtcgtc
acgactctggagaatgtcagccctccaagaagggcccgtgtgacagatgctactgagacc
accatcaccattagctggagaaccaagactgagacgatcaccggcttccaagtcgatgcc
atcccagccaacggccagactccgattcagagaaccatcaagccagatgtcagaagctac
accatcacaggtttacaacccggcactgactacaagatccacttgtacaccttgaatgac
aatgcccggagctcccctgtggtcatcgacgcctctactgccattgatgcaccatccaac
ctgcatttcctggccaccacacccaactctctgctgttatcatggcagccacctcgtgcc
aggattactggttacatcatcaagtatgagaagcccgggtcccctcccagagaagtggtc
cctcggccccgccctggtgtcacagaagctactattactggtctggaaccaggaatcgag
tacacaatccaagtcattgccctcaagaacaatcagaagagtgagcctctgatcgggagg
aaaaagacagatgagcttccccaactggtaacccttccacaccccaatcttcatggacca
gagatcctggatgttccctccacagttcaaaagacccctttcatcaccaaccctgggtat
gacactggaaacggtattcagcttcctggcacttctggtcagcagcccagtcttgggcaa
caaatgatctttgaggagcatggttttaggcgaaccacaccgcccacaatggccagcccc
gtaaggcataggccaagaccgtatccaccgaatgtaaatgaggagatccaaattggtcct
gtccccaggggagacgtagaccatcatctctaccctcacgttctgggactcaatccaaat
gcttctacaggacaagaagctctctctcagacaacaatctcatggaccccattccaggaa
agctctgagtatatcatttcatgtcatccagttggcattgatgaagaacccttgcagttc
cgagttcctggaacttctgctagtgccaccttgacgggtcttaccagaggggccacctac
aacatcatagtggaggcaataaaagaccagaagaggcacaaggttcgggagcaagtagtt
accgtgggcaattctgttgaccaaggcctaaaccaacccacggatgactcgtgcttcgac
ccctacacggtttcccattatgccattggagaggagtgggagcgattgtctgaatctggc
tttaaactctcatgccagtgcttaggctttggcagtggtcatttcagatgtgattcatct
aaatggtgccatgataatggtgtgaactacaagattggagagaagtgggatcgtcaggga
gaaagtggccagatgatgagctgcacgtgtcttggaaatggaaaaggagaattcaagtgc
gatccccatgaggcaacgtgttacgacgatgggaagacgtaccacgtgggagaacagtgg
cagaaagaatatcttggtgccatttgctcctgcacgtgctttggaggccagcggggctgg
cgctgtgacaactgccgcagaccaggggctgaacctggtcacgaaggctcaactggccac
tcctacaaccagtattcgcagagataccatcagagaacaaatactaatgtcaactgccca
attgagtgcttcatgcctttagatgtacaggctgacagagaagattcccgagagtaa

DBGET integrated database retrieval system