KEGG   Orcinus orca (killer whale): 101283112
Entry
101283112         CDS       T05247                                 

Gene name
PXN
Definition
(RefSeq) paxillin isoform X2
  KO
K05760  paxillin
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04062  Chemokine signaling pathway
oor04370  VEGF signaling pathway
oor04510  Focal adhesion
oor04670  Leukocyte transendothelial migration
oor04810  Regulation of actin cytoskeleton
oor05100  Bacterial invasion of epithelial cells
oor05135  Yersinia infection
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101283112 (PXN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101283112 (PXN)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101283112 (PXN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101283112 (PXN)
   04062 Chemokine signaling pathway
    101283112 (PXN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101283112 (PXN)
   05203 Viral carcinogenesis
    101283112 (PXN)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101283112 (PXN)
   05100 Bacterial invasion of epithelial cells
    101283112 (PXN)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101283112 (PXN)
   05163 Human cytomegalovirus infection
    101283112 (PXN)
   05165 Human papillomavirus infection
    101283112 (PXN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:oor04990]
    101283112 (PXN)
Domain-containing proteins not elsewhere classified [BR:oor04990]
 LIM domain-containing proteins
  Paxillin family proteins
   101283112 (PXN)
SSDB
Motif
Pfam: Paxillin LIM
Other DBs
NCBI-GeneID: 101283112
NCBI-ProteinID: XP_004281475
LinkDB
Position
Unknown
AA seq 591 aa
MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TVLDPLDQWQPSTSRFIHQQPPSPSPVYGSSAKTSSASNPQDGVGLPCPRAGEEEHVYSF
PNKQKSAEPSPTVMSSSLGSNLSELDRLLLELNAVQHNPPGYPADEANSSPPLPGALSPH
YGIPENNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
EMSSPQRVTSSQQQTRISASSATRELDELMASLSDFKIQGLEQRADGELCWAAGWPPNGS
QSSPEGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGA
CKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYC
NGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCA
RAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQK
PITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFVKLFC
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggacgacctcgacgccctgctggcagacttggagtccacgacctcccacatctccaaa
cggcctgtgttcttgtctgaggagaccccctactcgtacccaacaggaaaccacacatac
caggagattgccgtgccaccccctgtccctccacccccgtccagcgaggccctcaatggc
acggtccttgaccccttagaccagtggcagcccagcacctcccgattcatccaccagcag
cctccatccccgtcccccgtgtacggctccagtgctaaaacttccagtgcctccaacccc
caggacggcgtcggccttccgtgtccccgagctggcgaggaagagcacgtgtacagcttc
cccaacaagcagaagtcggccgagccttcacccaccgtcatgagctcctccttgggcagc
aacctttctgaactcgaccgcctgctgctggagctgaacgccgtgcagcataacccccca
ggctaccctgcagatgaggccaactcaagccccccactgcctggggctctgagcccccac
tacggcatcccggagaataacagcccgttggggggcaaagctgggccactgaccaaagag
aagcccaagcggaacggaggccggggcctggaggacgtgcggcccagcgtggagagtctc
ttggatgagctggagagctccgtgcccagccccgtccccgccatcactgtgaaccagggc
gagatgagcagcccccagcgagtcacctccagccagcagcagacacgcatctccgcctct
tctgccaccagggagctggatgagctgatggcctcgctgtcggattttaagatccagggc
ctggaacaaagagcggacggagagctgtgctgggcggccggctggcctccgaacggcagc
cagagcagccctgaagggcaggacgagggagggttcatggcccaggggaagacagggagc
agctctcccccgggagggcccccaaagcctgggagccagcttgacagcatgctggggagc
ctgcagtctgacctgaacaaactgggggtcgccacggtcgccaagggggtctgcggggcc
tgcaagaaacccatcgcggggcaggttgtgaccgccatggggaagacgtggcacccagag
cactttgtctgcacccactgccaggaggagatcggatcccggaacttctttgagcgggat
ggacagccctactgtgaaaaggactatcacaacctcttctctccacgctgctactattgc
aacgggcccatcctggataaagtggtgacagcccttgaccggacgtggcaccccgagcac
ttcttctgtgcccaatgtggagccttctttgggcctgaagggttccacgagaaagacggc
aaggcctactgccggaaggattactttgacatgttcgcccccaagtgtggcggctgtgcc
cgagccatcctggagaactacatctcggcccttaacaccctgtggcatcctgagtgcttt
gtgtgtcgggaatgcttcacaccatttgtcaacggcagcttcttcgagcacgacgggcag
ccctactgtgaggtgcactaccacgagcggcggggctcgctgtgctccggctgccagaag
cccatcacgggccgctgcatcaccgccatggccaagaagttccacccggagcactttgtc
tgtgccttctgcctcaagcagctcaacaagggcaccttcaaggagcagaacgacaagcct
tactgtcagaactgcttcgtcaagctcttctgctag

DBGET integrated database retrieval system