KEGG   Oceanisphaera profunda: CBP31_03925Help
Entry
CBP31_03925       CDS       T04856                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
opf  Oceanisphaera profunda
Brite
KEGG Orthology (KO) [BR:opf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CBP31_03925
Enzymes [BR:opf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CBP31_03925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO Glutaredoxin Thi4 FAD_binding_3 AlaDh_PNT_C K_oxygenase NAD_binding_8 FMO-like FMN_bind
Motif
Other DBs
NCBI-ProteinID: ART81878
UniProt: A0A1Y0D2X0
LinkDB All DBs
Position
901817..903379
Genome map
AA seq 520 aa AA seqDB search
MLDANLKTQLDAYLKNIVSPIEISVSSDNGPKGQELMTLAHEISQLSAQISLQEVQAKRS
PSMGIAAANQVPRIHFAGIPMGHEFTSLVLALLQTGGHPSKVSPELKQQVRELSGEYHFE
TYISLSCQNCPDVVQALNLMATLNPNITHVMIDGALFQEEVEQRQVMAVPAVYLNGEHFG
QGRISLEEIINKLDTGATDRQAASLNEQAPFDVLVVGGGPAGAAAAIYAARKGIRTGLVA
ERFGGQVQETMGIENFISVPYTEGPKLVASLEQHVKEYGVEMITNQRVADITAFSSTNSD
QAGLQVSLVSGATLKSRSVILATGARWRELNVPGEQEYRNKGVAYCPHCDGPFYKGKRVA
VVGGGNSGIEAAIDLAGIVEHVTVLEFGDSLRADEVLQRKARSLANIDIITNAQTTEVLG
DGQKVSGIHYIDRVSGELQHLSLAGIFVQIGLVPNTEFLQGSAVELTRFGEVIIDAKGAT
STPGVFAAGDATTVPYKQIVIAMGAGATAALSAFDHLIRN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgccaatttaaaaactcaactggacgcgtatttaaaaaatatcgtctcgcct
atcgaaatcagcgtgtccagtgacaacggccctaagggccaagaattaatgacgctggcc
cacgaaatcagccagctctcagcacagattagtttgcaagaagtgcaggctaagcgctca
cccagcatgggcatcgccgccgctaatcaagtaccacgcattcattttgccggcattcct
atgggccatgaatttacctcactggtattagccctgctgcaaaccggcggccacccgtca
aaagtatcgccagagctaaaacagcaagtacgcgagctatcaggcgaatatcactttgag
acttatatttcgttatcttgccagaactgccccgacgtggtgcaggcgctgaatctgatg
gccaccctgaatcccaatatcacccatgtcatgattgacggcgccctgtttcaagaggaa
gtcgagcaacgccaagtgatggcggtgcccgccgtctatctaaatggtgagcattttggt
caaggccgtatcagcctagaagaaatcatcaataagttggatacgggtgcgacggatcgc
caagctgccagcttaaatgagcaagcgcccttcgatgtattagtggtgggtggtggacca
gcaggtgccgcagccgctatttatgcggcgcgtaaaggtattcgtacaggattggtagcc
gaacgcttcggcggtcaggttcaggagaccatgggcatagagaactttatttccgtgccc
tacaccgaaggcccaaaactggtggcaagccttgagcaacacgtaaaagaatacggtgta
gagatgattaccaatcagcgcgtggcagacattacagcattttcttccactaactcggac
caagcaggcttacaagtttcattggtcagtggcgccacgcttaagagccgttcggtaatt
ttggcgaccggtgcccgctggcgagaactgaacgtgccgggtgaacaggaatatcgcaat
aaaggcgtggcctattgcccacactgtgacggccctttctataaaggcaaacgcgtggcg
gtggtcggtggcggtaactctggtatagaagcggccatcgacttggcgggtatagtggaa
catgtcaccgtattggagtttggcgactcgttacgtgcagatgaggtgctgcagcgcaaa
gctaggtctttggccaatatcgacattattaccaatgcccagactacagaagtgctgggt
gatggccagaaagtcagtggcatacattatatcgacagagtcagtggcgagctgcaacat
ttaagtttggcgggaatctttgtacaaatcggcttagtgcccaataccgagttcttgcag
ggctcagcggtagagctgacccgctttggtgaagtgatcatagacgccaaaggtgccacc
tccacccccggtgtgtttgccgccggtgatgcaactaccgtgccttataagcaaatcgtg
attgccatgggtgccggcgccaccgccgccttgagtgcctttgatcatttgattagaaac
tag

DBGET integrated database retrieval system