KEGG   Odobenus rosmarus divergens (Pacific walrus): 101370362Help
Entry
101370362         CDS       T05148                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1 isoform X1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00590  Arachidonic acid metabolism
oro01100  Metabolic pathways
oro04611  Platelet activation
oro04726  Serotonergic synapse
oro04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101370362 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101370362 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101370362 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    101370362 (PTGS1)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101370362 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 101370362
NCBI-ProteinID: XP_004411631
UniProt: A0A2U3WQY0
LinkDB All DBs
Position
Unknown
AA seq 632 aa AA seqDB search
MSRESDPDAPGETHLPPGGASTARLRANLSHSAGRSPSLRFPLLLLLLLPLPQVLPADPP
TPAPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPELWTWLRNSLRPSPSF
LHFLLTHGRWFWEFINATFIRDMLMRMVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYY
TRVLPSVPQDCPTPMGTKGKKQLPDAQLLGRRFLLRRKFIPDPQGSNLMFAFFAQHFTHQ
FFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE
APVLMHYPRGILPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQL
FQTARLILIGETIKIVIEEYVQQLSGYFLRLKFDPELLFSAQFQYRNRIAVEFNQLYHWH
PLMPDSFRVGSQEYSYEQFLFNTSMLVDYGVEVLVDAFSRQSAGRIGGGRNIDHHVLYVA
VEAIKESRELRLQPFNEYRKRFGMRPYTSFQELTGEKEIAAELEELYGDIDALEFYPGLL
LEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEMGFNMVKTATLKKLV
CLNTKTCPYVSFHVPNPHQDGGRAVEWPSTEL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtgagtccgaccctgatgcccccggggaaacccatttgccgcccggtggagcc
tcgacggccaggctccgcgctaatctctctcactcggcagggaggagtccctcgctccgg
ttcccgctgctcctgctgctgctgctgccgctgccccaggtcctgcccgcggaccccccg
acgcccgcgccggtgaacccctgttgttactacccatgccagcaccaggggatctgtgtc
cgcttcggccttgaccgctaccagtgtgactgcacccgcacgggctattctggccccaac
tgcaccatcccggagctgtggacctggctccggaattcgctgcgacccagcccctctttc
ctccacttcctgctgacgcatgggcgctggttctgggagttcatcaatgccaccttcatc
cgtgacatgctcatgcgcatggtactcacagtgcgttccaaccttatccccagccccccc
acctacaacatagcacatgactacatcagctgggagtccttctccaatgtgagctattac
actcgtgttctgccctctgtgccccaagactgccccacacccatggggaccaaagggaag
aagcagttgccagatgcccagctcctgggccgtcgcttcctgctcaggaggaagttcata
cctgacccccaaggcagcaacctcatgttcgccttctttgcacaacacttcacccatcag
ttcttcaaaacttctggcaagatgggtcctggcttcaccaaggccttgggccatggggta
gatcttggtcacatttatggggacaacctggaacgtcagtatcagctgcggctctttaag
gatgggaaactcaagtaccaggtgctggacggagagatgtaccccccttcggtggaggag
gcgcctgtgttgatgcactacccgcggggcattctgccccagagccagatggccgtgggc
caggaggtgtttgggctgcttcccgggctcatgctctatgccacgctctggctgcgcgag
cacaaccgagtgtgtgacctgctgaaggctgagcaccccacctggggtgatgagcaactc
ttccagacggcccgcctcatcctcatcggggagaccatcaagattgtaattgaggagtat
gtgcagcagttgagcggctacttcctgcggctgaagtttgacccggaactgctgttcagc
gcccagttccagtaccgcaaccgcatcgccgtggagttcaaccagctctaccactggcac
ccgctcatgcccgactccttcagggtgggctcccaggagtacagctacgagcagttcctg
ttcaacacctccatgctcgtggactatggggtcgaggtcctggtggatgccttctctcgc
cagagcgctggccggattggtgggggtagaaacatagaccaccacgtcctgtacgtggct
gtggaggccatcaaggaatcccgagagctgcggctgcagcccttcaatgagtaccgcaag
aggtttggcatgaggccctatacgtccttccaggagctcacaggggagaaggagatcgca
gccgagttggaggagctgtatggagacatcgatgccttggagttctacccggggctgctt
ctggagaagtgccatccaaactccatctttggggagagtatgatagaaattggggctccc
ttttccctcaagggcctcctagggaatcccatctgctctccagagtactggaaaccgagc
acatttggtggtgagatgggcttcaatatggtcaagacagccacgctgaagaagctggtc
tgcctcaacaccaagacttgtccatacgtctccttccacgtgcccaaccctcaccaggat
ggtgggcgtgctgtggagtggccgtccacagagctctga

DBGET integrated database retrieval system