KEGG   Odobenus rosmarus divergens (Pacific walrus): 101371488
Entry
101371488         CDS       T05148                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor NF-kappa-B p105 subunit isoform X1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01523  Antifolate resistance
oro04010  MAPK signaling pathway
oro04014  Ras signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04064  NF-kappa B signaling pathway
oro04066  HIF-1 signaling pathway
oro04071  Sphingolipid signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04210  Apoptosis
oro04211  Longevity regulating pathway
oro04218  Cellular senescence
oro04380  Osteoclast differentiation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04623  Cytosolic DNA-sensing pathway
oro04625  C-type lectin receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04668  TNF signaling pathway
oro04722  Neurotrophin signaling pathway
oro04917  Prolactin signaling pathway
oro04920  Adipocytokine signaling pathway
oro04926  Relaxin signaling pathway
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro05010  Alzheimer disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05030  Cocaine addiction
oro05132  Salmonella infection
oro05133  Pertussis
oro05134  Legionellosis
oro05135  Yersinia infection
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05146  Amoebiasis
oro05152  Tuberculosis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05202  Transcriptional misregulation in cancer
oro05203  Viral carcinogenesis
oro05206  MicroRNAs in cancer
oro05212  Pancreatic cancer
oro05215  Prostate cancer
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05222  Small cell lung cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05321  Inflammatory bowel disease
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101371488 (NFKB1)
   04014 Ras signaling pathway
    101371488 (NFKB1)
   04064 NF-kappa B signaling pathway
    101371488 (NFKB1)
   04668 TNF signaling pathway
    101371488 (NFKB1)
   04066 HIF-1 signaling pathway
    101371488 (NFKB1)
   04071 Sphingolipid signaling pathway
    101371488 (NFKB1)
   04024 cAMP signaling pathway
    101371488 (NFKB1)
   04151 PI3K-Akt signaling pathway
    101371488 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101371488 (NFKB1)
   04218 Cellular senescence
    101371488 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    101371488 (NFKB1)
   04620 Toll-like receptor signaling pathway
    101371488 (NFKB1)
   04621 NOD-like receptor signaling pathway
    101371488 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    101371488 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    101371488 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    101371488 (NFKB1)
   04660 T cell receptor signaling pathway
    101371488 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    101371488 (NFKB1)
   04659 Th17 cell differentiation
    101371488 (NFKB1)
   04657 IL-17 signaling pathway
    101371488 (NFKB1)
   04662 B cell receptor signaling pathway
    101371488 (NFKB1)
   04062 Chemokine signaling pathway
    101371488 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101371488 (NFKB1)
   04917 Prolactin signaling pathway
    101371488 (NFKB1)
   04926 Relaxin signaling pathway
    101371488 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101371488 (NFKB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101371488 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    101371488 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101371488 (NFKB1)
   05202 Transcriptional misregulation in cancer
    101371488 (NFKB1)
   05206 MicroRNAs in cancer
    101371488 (NFKB1)
   05203 Viral carcinogenesis
    101371488 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101371488 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101371488 (NFKB1)
   05221 Acute myeloid leukemia
    101371488 (NFKB1)
   05220 Chronic myeloid leukemia
    101371488 (NFKB1)
   05215 Prostate cancer
    101371488 (NFKB1)
   05222 Small cell lung cancer
    101371488 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101371488 (NFKB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101371488 (NFKB1)
   05022 Pathways of neurodegeneration - multiple diseases
    101371488 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    101371488 (NFKB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101371488 (NFKB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101371488 (NFKB1)
   04931 Insulin resistance
    101371488 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101371488 (NFKB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101371488 (NFKB1)
   05135 Yersinia infection
    101371488 (NFKB1)
   05133 Pertussis
    101371488 (NFKB1)
   05134 Legionellosis
    101371488 (NFKB1)
   05152 Tuberculosis
    101371488 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101371488 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    101371488 (NFKB1)
   05161 Hepatitis B
    101371488 (NFKB1)
   05160 Hepatitis C
    101371488 (NFKB1)
   05171 Coronavirus disease - COVID-19
    101371488 (NFKB1)
   05164 Influenza A
    101371488 (NFKB1)
   05162 Measles
    101371488 (NFKB1)
   05168 Herpes simplex virus 1 infection
    101371488 (NFKB1)
   05163 Human cytomegalovirus infection
    101371488 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101371488 (NFKB1)
   05169 Epstein-Barr virus infection
    101371488 (NFKB1)
   05165 Human papillomavirus infection
    101371488 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101371488 (NFKB1)
   05145 Toxoplasmosis
    101371488 (NFKB1)
   05140 Leishmaniasis
    101371488 (NFKB1)
   05142 Chagas disease
    101371488 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101371488 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101371488 (NFKB1)
Transcription factors [BR:oro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101371488 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_5 Ank_3 Death
Other DBs
NCBI-GeneID: 101371488
NCBI-ProteinID: XP_004401911
UniProt: A0A2U3W1N9
LinkDB
Position
Unknown
AA seq 972 aa
MAEDDTYLGGHEQMFHLDPLTHTIFNPELFQPEVPLTTADGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACTKGYNPGLLVHPDLAYLQA
EGGGDRQLTDREKEIIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGIWEGFGDF
SPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGAAGSTGPGYGFPHYGFPTYGGITFH
PGTTKSNAGMKHGTTDSPSKNDSEGCGKSVDREAASPPGKVTEPAEQDKESSTGGDEVTL
TYTMGVKEENSRFRDELFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENG
DSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEAVVEDLLR
AGADLSLLDRLGNSVLHLAAKEGQDKILSILLKHKKAALLMDHPNGEGLNAIHVAVTSNS
MPCLLLLAAAGADVNAQERKSGRTALHLAVERDNISLAGCLLLEGDAHVDSTTYDGTTAL
HIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKDGEDEGVVPGTTPLDMATNWQ
VFDILNGKPYEPEFTSDDLLAQGDMKQLTEDAKLQLYKLLEIPDPDKNWATLAQKLGLGI
LNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAAFCAPGTVASGPG
KVAPQTLSLPLSPASTRSPLDEARDDSICDSGVETSFRKLSFTESLTSGSSLLTLSKVPH
EYGQEGPIEGKI
NT seq 2919 nt   +upstreamnt  +downstreamnt
atggcagaagacgatacatatttgggagggcatgaacaaatgtttcatttggatcctttg
actcatacaatatttaacccagagttatttcaaccagaggtgccactaactacagcagat
ggtccataccttcaaatattagagcaacctaaacagagaggatttcgtttccgttatgta
tgtgaaggcccatcccatggtggactccctggtgcatctagtgaaaagaacaagaagtcc
taccctcaggtcaaaatctgcaactatgtgggacctgcaaaggttattgttcagttggtc
acaaatgggaaaaacatccacctgcatgcacacagcctggtgggaaaacactgtgaggat
gggatctgcactgtaactgctggacccaaggacatggtggtcggctttgcaaacttgggt
atacttcatgtgacaaagaaaaaagtatttgaaacactggaagcacgaatgacagaggca
tgtacaaagggctataatcccggacttttggtgcatcctgatcttgcctatttgcaagcg
gaaggtggaggagaccggcagctcacagatcgggaaaaggagatcatccgccaggcagct
cttcagcagacaaaggagatggacctcagcgtggtgcggctcatgtttacagcttttctt
ccagatagcaccggcagcttcacgaggcgcctggaacccgtggtgtcagacgccatctat
gacagcaaagcccccaatgcgtccaacttgaaaattgtaagaatggacaggacagctgga
tgcgtaactggaggggaagagatttatcttctctgtgacaaggttcagaaagatgatatc
cagattcgattttatgaagaagaggaaaatggtgggatctgggaaggatttggagatttt
tcccccacagatgttcatagacaattcgccatcgtcttcaaaactccaaagtataaagat
gtcaacatcacaaaaccagcttctgtgtttgtccaacttcgaaggaaatctgatttggaa
actagcgaacccaaaccttttctctactaccctgaaatcaaagataaagaggaagtgcag
aggaaacggcagaagctcatgcctaatttctcagatagtttcggcggcgggagtggggct
ggagccggaggcggaggcatgtttggcagtggcggtggaggaggggctgccggaagtacg
gggccagggtacggcttccctcactatggatttcctacatacggtggaattaccttccat
cctggaaccactaaatctaatgccgggatgaaacacggaaccacagacagcccatctaaa
aatgattctgaaggttgtggaaagagtgtggacagagaggcggccagcccccctgggaaa
gtaactgaacccgcagaacaagataaggagtccagcactgggggtgatgaggttactctg
acatatacaatgggagtaaaggaagagaactctaggtttcgggatgagctctttctagag
aaggctatgcagctggccaagcggcatgccaacgccctttttgactatgcggtgacagga
gatgtgaagatgctgctggctgtccagcgccacctcactgcagtgcaggatgagaatggg
gacagtgtcttacacttagcaatcatccatcttcatgcccagcttgtgagggatctacta
gaagtcacatctggtttgatttctgacgacattatcaatatgagaaatgatctctaccag
acacccttgcacctggcagtgatcaccaagcaggaggctgtggtggaggacttgctgcgg
gctggggccgacctgagccttctggaccgcttgggtaactctgttttgcacctagctgcc
aaagaaggacaagataaaattctcagtattttactcaagcacaagaaggcagcactactg
atggaccaccctaacggggaaggtctaaacgccattcacgtagccgtgacgagcaacagc
atgccgtgcctgctgctgctggcggcagccggcgccgacgtcaacgcgcaggagcggaag
tccgggcgcacggcgctgcacctggccgtggagcgcgacaacatctccctggcgggctgc
ctgctcctggagggtgatgcccatgtagacagtaccacctatgatgggactacagccctg
cacatagcagccgggagagggtccaccaggctggcagctcttctcaaagcggcaggtgca
gatcccctggtggagaactttgagcctctctatgacctggatgactcttgggaaaaagat
ggagaagatgaaggagtcgtgcctggaaccacacctctagatatggccaccaactggcag
gtgtttgatatattaaatgggaaaccatatgagccagagtttacatctgatgatttactt
gcacaaggagacatgaaacagctgactgaggatgcgaagctgcagctttacaagttgcta
gaaatccctgatccggacaagaactgggcaactctggcacagaaactaggtctggggata
ctgaataatgccttccggctgagtcctgctccttctaaaactcttatggacaactacgag
gtctccgggggcacggtgagagagctggtggaggccctgagacagatgggctacaccgaa
gccatcgaagtgatccaggcggccttctgcgccccgggcactgtggcctccggccccggg
aaggtggcgcctcagaccctctcgctgcccctctcacctgcctccacaaggtcgccatta
gacgaggcccgagacgacagcatctgcgacagcggcgtggagacgtccttccgcaaactc
agctttacagagtctctgaccagcggcagctccttgctgactcttagcaaagtgccccac
gagtacgggcaggaaggacccatagagggcaaaatctag

DBGET integrated database retrieval system