KEGG   Odobenus rosmarus divergens (Pacific walrus): 101377295
Entry
101377295         CDS       T05148                                 

Definition
(RefSeq) B-lymphocyte antigen CD20
  KO
K06466  B-lymphocyte antigen CD20
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101377295
Transporters [BR:oro02000]
 Other transporters
  Pores ion channels [TC:1]
   101377295
CD molecules [BR:oro04090]
 Proteins
  101377295
SSDB
Motif
Pfam: CD20 HyaE
Other DBs
NCBI-GeneID: 101377295
NCBI-ProteinID: XP_012423893
UniProt: A0A2U3ZY34
LinkDB
Position
Unknown
AA seq 297 aa
MTTPRNSRSGTFQADPMKGPTAMHPVQKIIPKRMPSVVGPTQNFFMRESKTLGAVQIMNG
LFHIALGGLLMIHTDIYAPICITVWYPLWGGIMYMISGSLLAAADKNPRKSLVKGKMIMN
SLSLFAAISGIIFLIMDIFNITISHFFKMDNLNLIKVSMPYINIHNCEPANPAEKNSLSI
QYCDSIRSVFLGIFAVMMIFTFFQKLVTAGIVEHEWKQLCSKPKSDVVVLLAAEGKKEQP
IETTDEMVELTEISSQPKNEEEIEIIPVQEEEEEMEINFPEPPQDQEPSPIENDSIP
NT seq 894 nt   +upstreamnt  +downstreamnt
atgacgacacccagaaattcaaggagtggaactttccaagcagatcctatgaaaggtcct
actgccatgcatcctgttcaaaaaataattcccaaaaggatgccttcagtggtgggccct
acacaaaacttcttcatgagggaatctaagacattaggggccgtccagattatgaatggg
ctcttccacattgccctaggcggcctcctgatgattcacacggatatctatgcacctata
tgtataactgtgtggtaccctctctggggaggcattatgtatatgatttctggatcactc
ctggcagcagcagacaaaaaccccaggaagagtttggtcaaagggaaaatgataatgaac
tcattgagcctctttgctgctatttctggaataatttttttgatcatggacatatttaat
attaccatttcccatttttttaaaatggataatttgaatcttattaaagtttccatgcca
tatattaacatacacaactgtgaaccagctaaccctgctgagaaaaactctctgtctata
caatattgtgacagcatacgatctgttttcttgggcatttttgctgtgatgatgatcttt
accttcttccagaaacttgtgacagctggcattgttgagcacgaatggaaacaactgtgc
tccaaacctaaatctgatgtagttgtcctgttagctgctgaagggaaaaaagaacagcca
attgaaacaacagatgaaatggttgagctgactgagatatcttcccaaccaaagaatgaa
gaagagattgaaattattccagtccaagaagaagaagaagaaatggaaataaactttcca
gaacctccccaggatcaggaaccttcaccaatagaaaatgacagcattccttaa

DBGET integrated database retrieval system