KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381594Help
Entry
101381594         CDS       T05148                                 

Gene name
AOC1
Definition
(RefSeq) amiloride-sensitive amine oxidase [copper-containing]
  KO
K11182  diamine oxidase [EC:1.4.3.22]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00330  Arginine and proline metabolism
oro00340  Histidine metabolism
oro00380  Tryptophan metabolism
oro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    101381594 (AOC1)
   00340 Histidine metabolism
    101381594 (AOC1)
   00380 Tryptophan metabolism
    101381594 (AOC1)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.22  diamine oxidase
     101381594 (AOC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2 Cu_amine_oxidN3 DUF1965
Motif
Other DBs
NCBI-GeneID: 101381594
NCBI-ProteinID: XP_004408860
UniProt: A0A2U3WJ56
LinkDB All DBs
Position
Unknown
AA seq 757 aa AA seqDB search
MQPDTLALGWAIAAILVLQALATAKCPSRTLHSQAGVFEDLSAQELKAVRNFLWSQEELK
LESSRAPTMAKNSVFLIEMLLPKKQHVLKFLDKGGRPPAREARAVIFFGAQAHPNVTEFA
VGPLPRPCYMRELPPKPGHHTTWASRPITGAEYALLAQALQEATKPLHRFFLDTTGFSFQ
DCHSRCLTFTDVAPRGVASGQRRSWFILQRFVEGYFLHPTGLELLMDHGSTNAQDWTVEL
VWYNGKFYQSPEELARKYEEGQVDVVVLEDLPAKGQGGEGTEETPLFSSYKPRGAFPTPI
PANGPRLVQPRHRYRLEGNTVLYGGWSVSFRLRSSSGLQILNVLFGCERIAYEVSVQEAV
ALYGGHTPAGMQTNYIDVGWGLGSVTHELAPGIDCPDTATFLDALHHYDADGPVRYPRAL
CIFELPTGVPLRRHFNSNFSGGFNFYAGLQGQVLVLRTTSTVYNYDYIWDFIFYPNGVME
AKMHATGYVHATFYTPEGLRYGTRLHTHLLGNMHTHLVHYRVDLDVAGTKNSFQTLQMKL
ENITNPWSPRHHLVQPTLKQTSYHRERQAAFRFGRLLPKYLLFTSPEENRWGHKRSYRLQ
IHSMADQVLPVGWQKERAVTWARYPLAVTKYRESEVCSSSIYNQNDPWDPPVVFEEFLHN
NENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNFFPEDPSLASRDTVIV
WPRNSGPNYIQHWTPKEEEGDCLMPDPFSYNGTYRPV
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagataccctggccctcggctgggccatagctgccatcctggtgctgcaggcg
ctggccacggccaagtgcccctcacggaccctgcacagccaggccggagtgttcgaggac
ctgagcgcccaggaactgaaggccgtgcgcaacttcctctggtcgcaggaggagctgaag
ctggagtcctcccgagcacccaccatggccaaaaactccgtgttcctcattgagatgttg
ctgcccaagaagcaacacgtactgaaatttctggacaaaggtggaaggcctcccgcccgc
gaggcccgagccgtcatcttcttcggagcccaggcgcatcccaatgtcacggagttcgcg
gtggggcccctgccgcggccctgctacatgcgagagctgcctcccaagccggggcatcac
acaacctgggcctccaggcccatcaccggggccgagtacgccctcctggcccaggccctg
caggaggccaccaagcccctgcaccgattttttcttgataccacaggcttctctttccaa
gactgtcactcgcgatgcctgacattcacagacgtggcgcctcggggcgtggcctccggc
cagcgccgctcttggttcatcttgcagcgctttgtagaaggctacttcctgcaccccacg
gggctggagctcctcatggatcacggcagcaccaacgcccaagactggacggtggagctg
gtctggtacaacgggaagttctaccagagcccagaagagctggcacggaagtatgaggag
ggacaggtggacgtggtggttctggaggacctacccgccaagggccagggcggggaaggc
acagaggaaacacccctcttctcctcctacaagccgcgcggggccttccccacccccatc
cccgcaaacggcccccgcctggtccagccccgtcaccgctacagactggagggcaacacc
gtgctctacggcggctggagcgtctccttcaggctgcgctcgtcctcggggctgcagatc
ctcaacgtgctgttcggctgcgagcgcatagcctacgaagtgagcgtgcaggaggcggtg
gcactgtatggagggcacacgcccgcgggcatgcagaccaactacatcgacgtgggctgg
gggctgggcagcgtcacgcacgagttagcgcccggcatcgactgcccggacacagccacc
ttcctggatgccctccaccactacgatgccgatggccccgtgcgctacccccgagccctc
tgcatctttgagctgcccacgggagtgccccttcggcgacactttaattccaacttcagt
gggggcttcaacttctacgcggggctgcaaggccaggtgctggtgctacggaccacgtcg
acggtctacaactatgactatatctgggacttcatcttctaccccaatggggtgatggaa
gccaagatgcatgccaccggctacgtccacgccaccttctacacccccgaggggctgcgc
tacgggacccgcctgcacacgcacctgcttggcaacatgcacactcacttagtgcactac
cgcgtggacctggacgtggcaggcaccaagaatagcttccagaccctgcagatgaagcta
gaaaacatcaccaacccctggagcccaagacaccacctggtccagccaaccctgaagcag
acaagttaccaccgggagcgccaggcggccttccgcttcggacgacttctgcccaagtac
ctgctcttcacgagtcccgaggagaaccgctggggtcataagcgcagctaccggctacag
atccactccatggccgaccaggtgctgcccgtgggctggcagaaggagcgggctgtcacc
tgggccaggtaccccctggcagtgaccaaataccgggagtcagaggtgtgcagtagcagc
atctataaccagaacgacccctgggacccacctgtggtctttgaggagtttcttcacaac
aatgagaacattgaaaacgaggacttggtggcctgggtcaccgtgggcttcctgcacatc
ccccactcagaggacatccctaacacggccacacccggaaactctgtgggcttccttctc
cggcctttcaacttcttccctgaggacccatccctggcatccagagacaccgtgatcgtg
tggccccggaacagcggccccaactacatccagcactggaccccgaaggaggaggagggg
gactgcttgatgcctgacccttttagctacaatggaacctacaggcctgtgtga

DBGET integrated database retrieval system