KEGG   Opitutus terrae: Oter_1961Help
Entry
Oter_1961         CDS       T00689                                 

Definition
(GenBank) Beta-ketoacyl synthase
Organism
ote  Opitutus terrae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt AMP-binding KR Ketoacyl-synt_C PP-binding KAsynt_C_assoc adh_short adh_short_C2 Acyl_transf_1 Thiolase_N Epimerase Polysacc_synt_2 GDP_Man_Dehyd NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ACB75244
UniProt: B1ZYK8
LinkDB All DBs
Position
2457937..2464248
Genome map
AA seq 2103 aa AA seqDB search
MNLPSSSASVPSTLVALLRGRAQHQPDRRAYLFLADGETEEASFTYAELDRRARAIAARL
QTITACGDRALLLYPPGLEFLAAFFGCLYAGVIAVPSYPPKRNRPDRRLQAIAADAGATV
VLTNAEVADDLEARLTHSPELRAWQWLATDRIPTDEAAGWRDPQVRGDDLAFLQYTSGST
STPKGVMVSHGNLLHTLDDLDRGWDHTPDSVMVTWLPIFHDLGLIYGALIPLFKGFFCVM
LPPPAFLQRPVRWLEAISRYRATHSAAPNFAYDLCVAGTTPEQRARFDLRSWRMSLNAAE
PVRAETLAAFNAAFAPCGLSPLTVTPGFGLAEATLKVSALPCAEPTRIVHVRSDELAQHR
VVLGGPGTDGVQPIVGCGWRGRTDNRYLIVDPVTCEPCAEDHVGEIWFAGASVALGYWKR
PAETAETFQARLANGDGPFLRTGDLGFVRGEELFVTGRVKDLIIIRGLNHYPQDIELTVE
KGHPALRPACGAAFSVEIDGHETLVIAQEVERTYLRKLNVDEVVAAIRKAVAEQHDLQVS
AIALLRTNSVPKTSSGKIMRRACRQQYLAGELELVGEWRSPVSSAPPFDATAAAARGSVE
QALVVTWLVEQLAQRLQLDPKQIDAGEPFSRYGLDSMTAVELSGELERWMGRRLPPTLIY
DYPSIQALASHLVALVDEPDAGTKPATEKSDPTGGAADELNPIAVVGMGCRFPGAESTAE
FWTLLRDGREAITRVPPGRWDPATADAPEWGGFLPDVEAFDAEFFGIAPREADLMDPQQR
ILLEVAYAALEDAGIVPRSLAGSRTGVFVGISTNDYGRLLARVAAGTDAHAGTGNALSIA
ANRISYLLDLRGPSLVLDTACSSSLVAVHHAVRSLRAGESTLALVGGVNLILAPELTTTF
ARAGMLAPDGRCKTFDAAANGYVRGEGCGVLVLKRLRDAERDGDRVLAVIRGSAINQDGR
SNGLTAPNGPAQQAVVRAALRDAAIPASALSYVEAHGTGTSLGDPIEVNALRDVLLEQRD
PQAPCWIGSVKTNIGHLEAAAGIAGLIKVVLALQHRTLPPHLHLRAVNPLIQLANTPISI
PTVPTPWPGLVRVAGVSSFGFGGTNAHVIVSEPRVPRPADNPPAPRRAEHALVLSARTAP
ALRALAASYVARIAEARSGEEWTDLCHAAATQRGHFAHRLAVNADRAHLLAGFSQGAAAS
GVWQGEAGEPPRLALWFPSEADQRAELVGELYASLPVFRAAVDECRAELASRTSWDLTSA
FNSPSSAIPVELSGAVAFAVGYALHRAWRAWGVEPVAVSGAGAGEIAAAVAAGVLSRSEA
IALLFGDAIPPKAAAGAVGGNGRASKPPALISAETGAAIGAEARQREFWLAPLKPPFRSR
IAADALHAAGVVLSIDLGSADEAARATGDVWLPALRKDGRGWQAMLDAAAQAFVRGVPIR
WQEVDRGFAFARVELPHYPFQRQRHWFDPTPAVADVDELARLAVQLAIEPELSPSERAAA
PAVIAALLRAHHRSGDPLAGYTYEVRWPAEPLGVPAAPAAGRWLVLGPAPQELESIFDAN
GQTLERAEAFRSGDWRGALFWAGDEPGESEAARLLRAMQTANVPLWIATRGAVATSADDA
RVRLDHAPLWGMGKVYALEHPERWGALIDLPADPTAVDLASLVAELLGHPAGEDQVAWRG
GVRHVARLEPAPLPPVSPLPVLRADAAYWVTGGTGALGLQVAQWLVARGARRLVLTARRS
PGVTALARIADLEKAGVTVRCLAADVAVEQDVRRVLAQVGAELGPVRGIVHAAGVVSRVS
IAELTPEALADVLRPKLGGARALDAATAGHELDFFVLFSSIAALWGAKGQAHYAAANAAL
DALAQQRRATGRPALSVGWGPWSGGGMAGPEEQALLARYGVSPLDPAVALAALDRALGGT
RAQVAVARVDWAVFKEFFELHGAKPFLALVGGRREPAAAGRLEAELAALATAAPEQRRGG
MEAFLQQQVAAVLGFKDGRLPEVRQGFFALGMDSMMAVDLGRRLSQACGRTLSSTLVFDH
ASIHLLAAHLVETLFGADGRIAAPAAPTAAAETAGAATAAEETDVETALAQRLEKLESLI
RST
NT seq 6312 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacccagctcctccgcttcggtgccgtcgacccttgtcgcgctgttacgcggc
cgcgcgcagcaccagcccgaccgccgcgcctaccttttcctggcggatggcgaaaccgag
gaggccagtttcacctatgccgagctcgaccggcgcgcgcgcgcgatcgcggcgcggctg
cagacgatcacggcgtgcggcgatcgcgcgctgctgctgtacccgcccgggctggagttt
ctcgcggcgttctttggctgcctctatgccggcgtgatcgcggtgccgagctatccgccg
aaacgcaaccgcccggatcgccggctgcaggcgatcgcggccgatgccggcgcgacggtg
gtgctcaccaacgccgaggtggccgacgacctggaagcgcggctcacgcattcgcccgag
ctgcgcgcgtggcaatggctggcgactgaccggattccgaccgacgaggcggccggctgg
cgcgatccgcaggtgcgcggggacgacctcgcgtttctccagtatacgtcgggctccacg
tcgacgccgaagggcgtgatggtgtcgcacggcaacctgctccacacgctcgatgatctc
gaccgcggctgggatcacacgcccgacagcgtgatggtcacctggctgccgatctttcac
gacctcgggctgatttacggcgcgctgattccgctgttcaaggggttcttctgcgtgatg
ctgccgccaccggcgttcctgcagcgaccggtgcgctggctcgaggcgatcagccgctac
cgggccacgcacagcgcggcgccgaactttgcctacgacctgtgcgtcgccggtacgacg
cccgagcagcgggcccgcttcgatctgcgctcgtggcggatgtcactcaacgccgccgag
ccggtgcgcgcggagacgctcgcggcgttcaacgcggcgttcgcgccgtgcggtctctcg
cccctcaccgtcacgcccggtttcgggctggccgaggcgacgctgaaggtctcggcgctt
ccctgcgccgagccgacgcggatcgtacacgtgcgcagcgacgagctggcgcagcaccgc
gtggtccttggcgggcccggcaccgacggcgtgcagccgatcgtcggctgcggctggcgg
ggacggaccgataaccgctacctgatcgttgatccggtgacgtgcgagccctgcgccgag
gaccacgtgggcgaaatttggttcgccggcgcgtcggtcgcgctcgggtattggaagcgc
cccgccgaaaccgccgagacgtttcaggcacggctcgcgaacggcgatgggccgtttctg
cggacgggcgatctcggcttcgtgcgcggcgaggagctgttcgtcaccggccgcgtgaag
gacctgatcatcattcgcgggctgaaccactatccgcaggacatcgagctcaccgtcgag
aaaggccacccggcgctgcggcccgcgtgcggcgcggcgttctcggtggagatcgacggg
cacgaaacgcttgtgatcgcgcaggaggtggagcggacgtatttgcgcaagctcaacgtc
gacgaggtcgttgccgcgatccgcaaggccgtcgcggagcagcacgacctgcaggtcagc
gcgatcgcgctgctgcggacgaattcggtaccgaagacgtcatcgggcaagatcatgcgc
cgcgcctgccggcagcagtatctcgccggcgaactcgagctcgtcggcgagtggcgctcg
ccggtctcgagcgcgccaccgttcgacgcgaccgcggcggcggcgcgcggctcggtcgag
caggcgctggtggtcacctggctcgtcgaacagctcgctcagcggctgcagctcgatccg
aagcagatcgatgccggcgagccgttctcgcgctacgggctggactcgatgaccgcggtg
gaactgtccggcgaactcgaacgctggatgggtcgccggctgccgccgacgctgatctac
gattacccgagcatccaggcgctcgcgagtcacctcgtcgcgctggtcgacgaacccgac
gcgggcacgaaaccggcgacagaaaagtctgacccgaccggcggcgcggccgatgaactc
aacccgatcgccgtcgtcgggatgggctgtcggttccccggcgcggaatcgaccgcggag
ttctggacgctgctgcgcgacgggcgcgaggcgatcacgcgtgtgccgcccggtcgctgg
gatcccgcgacggccgatgcgcccgagtggggcggttttctgccggacgtggaggcgttt
gatgccgagttcttcggcatcgccccgcgcgaggcggacctgatggacccgcagcagcgg
atcctgctcgaagtcgcctacgccgcgctggaggacgccggcatcgtgccccgctcgctc
gccggctcgcgcaccggcgtgttcgtcggcatcagcaccaacgactacggccggttgctc
gcgcgcgtggccgccggcacggacgcacacgccgggaccggaaacgcgctgagcattgcg
gccaatcgcatttcctacctgctcgatcttcgcggcccgagcctcgtgctcgacaccgcg
tgctcgtcctcgctggtcgccgtgcaccacgcggtgcgcagcctccgcgccggcgagtcg
acgctcgcgctcgtcggcggcgtcaatctcatcctcgcgcccgagctgaccaccaccttt
gcgcgcgccggcatgctcgcgccggatggacgctgcaagaccttcgatgccgcggcgaac
ggctacgtgcgcggcgaaggctgtggcgtgctcgtgctcaagcggctgcgcgacgcggaa
cgcgacggcgaccgggtgctcgcggtgattcgcggcagcgcgatcaatcaggacggccgc
agcaacggactcaccgcgcccaacggccccgcgcagcaggcggtggtgcgcgcggcgttg
cgcgacgcggcgatccccgcgtcggcgctgagttacgtcgaggcgcacgggacgggcacg
tcgctcggcgatcccattgaggtgaacgcgctgcgcgacgtcttgctcgagcagcgcgat
ccgcaggcgccgtgctggatcggctcggtcaagaccaacatcggccacctcgaagcggcg
gccgggatcgccggtctgatcaaggtcgtgctcgcgctgcaacaccgcacgctgccgccg
cacctgcacctgcgcgccgtcaatccgctgatccagctggcgaatacacccatttcgatc
ccgaccgtgcccacgccgtggcccggcctggtgcgggtggcaggcgtcagctcgttcggt
tttgggggcaccaacgcgcacgtgatcgtgagcgaacccagggtgcctcggccggcggac
aatccgccggcgccacggcgcgcggagcacgcgctggtgctgtcggcgcggactgcgccg
gcgttgcgggcgctcgccgccagctatgtggcccggatcgccgaggcacgcagcggcgaa
gaatggacggatctctgtcatgcggcggcgacccagcgcgggcacttcgcgcaccggctg
gcggtgaacgccgaccgcgcgcacctgctcgcgggtttctcgcagggagcggccgcatcc
ggtgtctggcagggcgaggccggtgagccgccgcgactcgccttgtggtttccgagtgag
gcagatcagcgtgccgaactcgtcggggagctgtatgcgtcgctgccggtgttccgtgcg
gcggtggacgaatgtcgcgcggagctggcgagccgcaccagctgggacctgacctcggcg
ttcaactcgccgtcgtcggcgattcccgtggagctgtcgggcgcggtggcgtttgcggtc
ggctacgccctgcatcgcgcctggcgcgcgtggggcgtggagccggtggcggtctccggt
gccggcgccggagagatcgccgcggctgtggccgcaggtgtgctgtcgcgcagcgaggcg
atcgcgctgctgttcggcgacgcgattccgccaaaagcggcggcgggtgcggtcggcgga
aacggccgggcgtcgaaacctccggcgctgatttccgccgagaccggcgcggccatcggc
gccgaggcgcggcagcgggaattctggctggcgccgctgaaaccgcccttccggtcgcgg
atcgccgccgacgccttgcacgccgccggcgttgtgctgagcattgatctggggtcggca
gacgaggccgcgcgagcgacgggcgacgtgtggctgcccgcgcttcggaaggatgggcgt
ggctggcaggcgatgctcgacgcggccgcgcaagcgtttgtgcgcggcgtgccaatccgc
tggcaggaagtcgaccgcggattcgcgttcgcgcgcgtcgagcttccacactatcccttc
cagcggcagcggcactggttcgacccgacgcccgctgtcgccgacgtggacgagctcgcg
cggctggcggtccagctggcgatcgagccggagctgtctccgagtgagcgggcggctgcg
cccgcggtgatcgcggccttgctgcgcgcgcaccaccgtagcggcgatccgctcgccggc
tatacgtacgaggtgcgctggccggcggagccgcttggcgtgccggccgcgccggctgct
ggacgctggctggtgcttggtcccgcaccgcaggaactcgaatcgatctttgacgcgaac
ggccagacgctcgaacgcgcggaggcgtttcgctccggcgattggcgcggagcgctgttc
tgggcgggcgacgaacccggcgagtctgaggcggcgcggctgctgcgcgcgatgcagacc
gcgaacgtgccgctgtggatcgccacccgcggcgcggtggcgacgagcgcggacgacgcc
cgggtgcggctcgatcacgcgccgctgtggggcatgggcaaggtgtacgcgctcgaacat
ccggagcgctggggagcgctgatcgatctgcccgccgacccgacggcagtggatctcgcg
agtctcgtcgcggaattgctgggacatccggccggcgaggaccaggtcgcgtggcgcggg
ggagtgcgtcacgtcgcgcgactcgaaccggcaccgctgccgccggtaagtccgctgccg
gtcctgcgcgcggacgcggcgtattgggtgaccggcggaaccggcgcgctcggcttgcag
gtggcgcaatggctcgtggcccgcggggcacgacggctggtgctgacggcgcgacggagc
ccgggcgtgacggcgctggcacggatcgcggatctggagaaagcgggcgtgaccgtccgg
tgcctggcggccgacgtcgccgtcgagcaggacgtccgtcgcgtgcttgcgcaggtgggc
gccgagctcggaccggtccgcggcatcgtgcatgcggccggcgtcgtgagccgggtgtcg
atcgcggagctgacgcccgaggcgttggccgacgtgttgcggccgaaactcggtggagca
cgcgcgctggacgcggcaaccgcggggcatgagctggatttcttcgtgctgttttcgtcg
atcgccgcgctctggggcgcgaagggccaggcgcattacgccgccgcgaacgccgcgctc
gacgcgctcgcgcagcagcggcgcgccaccggacgtccggcgctcagcgtcggctggggg
ccgtggagtggcggaggcatggccgggccggaggagcaggcgctgcttgcgcgctacggc
gtgagcccgctcgatcccgcagtggcactcgccgcgctcgatcgtgcgctgggcgggacg
cgggcgcaggtcgcggtggcgcgcgtcgactgggccgtgttcaaggagttcttcgaactg
cacggcgcgaagccgttcctggcgttggtcggcgggagacgtgaacccgccgcggccggc
cggctcgaggccgagctggccgcgctggcgactgccgcgccggagcaacgccgcggcggg
atggaggcgtttttgcagcaacaggtggcggcggtgctcgggttcaaggacggccggctg
ccggaggtgcgccagggcttcttcgcgctcggcatggactcgatgatggcggtggacctt
gggcggcggctgtcgcaggcgtgcggccggacgttgtcgtcgacgctggtgttcgaccac
gccagcattcacctgctcgcggcgcatctggtggaaacgctgttcggcgccgatgggcgg
atcgccgcgccggcggcgccgactgccgcggcggaaacagcgggggcggcaacggcggcc
gaggaaaccgatgtggagaccgcgctcgcgcagcggctcgaaaaattggagtcgttgatt
cgctccacgtga

DBGET integrated database retrieval system