KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215451
Entry
112215451         CDS       T05605                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 10-like
  KO
K04721  tumor necrosis factor ligand superfamily member 10
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04210  Apoptosis
otw04217  Necroptosis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112215451
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112215451
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112215451
   04217 Necroptosis
    112215451
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112215451
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112215451
   04052 Cytokines and growth factors [BR:otw04052]
    112215451
   04090 CD molecules [BR:otw04090]
    112215451
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112215451
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Tumor necrosis fators
   112215451
CD molecules [BR:otw04090]
 Proteins
  112215451
SSDB
Motif
Pfam: TNF Phage_holin_3_6
Other DBs
NCBI-GeneID: 112215451
NCBI-ProteinID: XP_024230281
LinkDB
Position
16
AA seq 354 aa
MTQVMFLFLTVALPAPPSLFPSPPSTSLFLCGRKGGRSYSYSLFTAFVLKPERSRAGREA
VVGMAGGSSGFTFLGVLLLAAILLQTVAVTVTVLYFTNVLNTMKETFARSSVSCLTRSDL
RGGYVRSPIEGRGDPCWQVTQQLHTLIEKSLFQRYQREISSAVRDEMSRVMPSLAMEDQA
SSRPKVAAHVTGSFAPKAPREGGGSAGRRVQGQKISWWEGHKGLAFLQDVRLIDGELVVP
CPGLYYIYAQTYFRHTHPGGEEGEEEVEEEREQRGRPMLQYVYKKVSSYPVPILLMKTSR
TSCWSRDSQFSLHSAHQGGLFPLATGDRLLVTVSNASAIDMDERSSFFGAVLVS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgactcaagtcatgtttttgttcttaaccgtggccttgcctgctcctccctctctcttt
ccctctcctccctctacctctctctttctgtgcgggaggaaggggggcagaagttatagt
tactctctcttcacagcttttgttctgaaaccggagcgtagcagagcagggcgcgaggcg
gtggtcggtatggcgggaggctcgagcggcttcacatttctcggggttctgctgctcgcg
gccattctgctgcagaccgtggccgttaccgtcaccgtgctctacttcaccaacgtcctc
aacacgatgaaggagacatttgcaaggagcagtgtgtcttgtctgacacggtctgacctc
agaggggggtatgtgcgctccccgatcgaggggagaggagacccctgctggcaggtcaca
cagcaactacacaccctcatagagaagtctctgtttcagcgatatcagagggagatctcc
tcagcagttagagacgagatgtccagggtgatgccctcactggcaatggaggaccaggct
tcttctcgccccaaagttgccgcccacgtcactggcagcttcgctcccaaagcaccgagg
gagggaggaggttctgccgggcggcgtgtgcaggggcagaagatctcgtggtgggagggg
cataaagggctggcattccttcaggatgttcgattgattgatggggagctggtggtgcct
tgcccaggactctactatatctatgcccagacctacttcagacacacccaccctggggga
gaggagggggaggaagaggtggaagaggagagggagcagagggggaggcccatgttgcag
tatgtttataagaaagtgtcttcctatccggtacccatcctgctaatgaagaccagccgt
acctcctgctggtcccgggattcccagttctctctacactcggcccaccagggagggctg
ttcccattggccacaggggaccgcctcctcgtcaccgttagcaacgcctctgccatcgac
atggatgagaggagcagctttttcggggctgtcctggtcagctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215470
Entry
112215470         CDS       T05605                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 10-like
  KO
K04721  tumor necrosis factor ligand superfamily member 10
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04210  Apoptosis
otw04217  Necroptosis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112215470
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112215470
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112215470
   04217 Necroptosis
    112215470
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112215470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112215470
   04052 Cytokines and growth factors [BR:otw04052]
    112215470
   04090 CD molecules [BR:otw04090]
    112215470
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112215470
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Tumor necrosis fators
   112215470
CD molecules [BR:otw04090]
 Proteins
  112215470
SSDB
Motif
Pfam: TNF Phage_holin_3_6
Other DBs
NCBI-GeneID: 112215470
NCBI-ProteinID: XP_024230296
LinkDB
Position
16
AA seq 354 aa
MTQVMFLFLTVALPAPPSLFPSPPSTSLFLCGRKGGRSYSYSLFTAFVLKPERSRAGREA
VVGMAGGSSGFTFLGVLLLAAILLQTVAVTVTVLYFTNVLNTMKETFARSSVSCLTRSDL
RGGYVRSPIEGRGDPCWQVTQQLHTLIEKSLFQRYQREISSAVRDEMSRVMPSLAMEDQA
SSRPKVAAHVTGSFAPKAPREGGGSAGRRVQGQKISWWEGHKGLAFLQDVRLIDGELVVP
CPGLYYIYAQTYFRHTHPGGEEGEEEVEEEREQRGRPMLQYVYKKVSSYPVPILLMKTSR
TSCWSRDSQFSLHSAHQGGLFPLATGDRLLVTVSNASAIDMDERSSFFGAVLVS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgactcaagtcatgtttttgttcttaaccgtggccttgcctgctcctccctctctcttt
ccctctcctccctctacctctctctttctgtgcgggaggaaggggggcagaagttatagt
tactctctcttcacagcttttgttctgaaaccggagcgtagcagagcagggcgcgaggcg
gtggtcggtatggcgggaggctcgagcggcttcacatttctcggggttctgctgctcgcg
gccattctgctgcagaccgtggccgttaccgtcaccgtgctctacttcaccaacgtcctc
aacacgatgaaggagacatttgcaaggagcagtgtgtcttgtctgacacggtctgacctc
agaggggggtatgtgcgctccccgatcgaggggagaggagacccctgctggcaggtcaca
cagcaactacacaccctcatagagaagtctctgtttcagcgatatcagagggagatctcc
tcagcagttagagacgagatgtccagggtgatgccctcactggcaatggaggaccaggct
tcttctcgccccaaagttgccgcccacgtcactggcagcttcgctcccaaagcaccgagg
gagggaggaggttctgccgggcggcgtgtgcaggggcagaagatctcgtggtgggagggg
cataaagggctggcattccttcaggatgttcgattgattgatggggagctggtggtgcct
tgcccaggactctactatatctatgcccagacctacttcagacacacccaccctggggga
gaggagggggaggaagaggtggaagaggagagggagcagagggggaggcccatgttgcag
tatgtttataagaaagtgtcttcctatccggtacccatcctgctaatgaagaccagccgt
acctcctgctggtcccgggattcccagttctctctacactcggcccaccagggagggctg
ttcccattggccacaggggaccgcctcctcgtcaccgttagcaacgcctctgccatcgac
atggatgagaggagcagctttttcggggctgtcctggtcagctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227478
Entry
112227478         CDS       T05605                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 10-like
  KO
K04721  tumor necrosis factor ligand superfamily member 10
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04210  Apoptosis
otw04217  Necroptosis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112227478
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112227478
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112227478
   04217 Necroptosis
    112227478
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112227478
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112227478
   04052 Cytokines and growth factors [BR:otw04052]
    112227478
   04090 CD molecules [BR:otw04090]
    112227478
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112227478
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Tumor necrosis fators
   112227478
CD molecules [BR:otw04090]
 Proteins
  112227478
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 112227478
NCBI-ProteinID: XP_024248063
LinkDB
Position
29
AA seq 293 aa
MAGGSSGVSFLGVLLLAAILVQTVAVTVTVLYFTNVLNTMKEMLQGACVVSDTGRPQRGH
VRLSTEGRGDPAGRSHSNTHPHREGNTQLFVSAISEGSSSAVRDEVPGCYPHGDGGPGSF
SPPQSRCPRHWQLGSQSREGGGGSPGRRVQGQKISWWEGHNGLAFLQEVRLVDGELVVPR
PGLYYIYAQTYFRHTHPEGEEGEEEEEEDREQRGRPMLQYVYKKVSSYPVPILLMKTSRT
SCWSRDSQFSLHSAHQGGLFPLAAGDHLLVTVSNASAIDMDERSSFFGAFLVS
NT seq 882 nt   +upstreamnt  +downstreamnt
atggcgggaggctcaagcggcgtctcatttctcggggttctgctgctcgctgcgattctg
gtgcagaccgtggccgttactgtcaccgtgttatacttcactaatgtcctcaacacgatg
aaggagatgttgcaaggagcttgtgtcgtgtctgacacgggccgacctcagaggggacac
gtacgcctctccaccgaggggagaggagaccccgctggcaggtcacacagcaacacacat
cctcatagagaaggtaacacacaactctttgtctcagcgatatcagagggaagctcctca
gcagttagagatgaggttccagggtgttaccctcatggtgatggaggaccaggctccttc
tcgccgccccaaagtcgctgcccacgtcactggcagcttggctcccaaagcagagagggg
ggaggaggttccccggggcggcgtgtgcaggggcagaagatctcatggtgggaggggcat
aatgggctggcattccttcaggaagtccgattggttgacggggagctggtggtgcctcgc
ccaggactctattatatctatgcccagacctacttcagacacacccaccccgagggagag
gagggggaggaagaggaggaagaggacagggagcagagggggagacccatgctgcagtat
gtctataagaaagtgtcctcctacccggtacccatcctgctgatgaagacaagcaggacc
tcctgctggtcccgggactcccagttttctctgcactccgcccaccagggggggctgttc
ccattggctgccggagatcacctcctcgtcaccgttagcaatgcctccgccatcgacatg
gatgagaggagcagcttcttcggggctttcctggtcagctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112236919
Entry
112236919         CDS       T05605                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 10-like
  KO
K04721  tumor necrosis factor ligand superfamily member 10
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04210  Apoptosis
otw04217  Necroptosis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112236919
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112236919
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112236919
   04217 Necroptosis
    112236919
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112236919
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112236919
   04052 Cytokines and growth factors [BR:otw04052]
    112236919
   04090 CD molecules [BR:otw04090]
    112236919
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112236919
Cytokines and growth factors [BR:otw04052]
 Cytokines
  Tumor necrosis fators
   112236919
CD molecules [BR:otw04090]
 Proteins
  112236919
SSDB
Motif
Pfam: TNF Phage_holin_3_6
Other DBs
NCBI-GeneID: 112236919
NCBI-ProteinID: XP_024261304
LinkDB
Position
Unknown
AA seq 354 aa
MTQVMFLFLTVALPAPPSLFPSPPSTSLFLCGRKGGRSYSYSLFTAFVLKPERSRAGREA
VVGMAGGSSGFTFLGVLLLAAILLQTVAVTVTVLYFTNVLNTMKETFARSSVSCLTRSDL
RGGYVRSPIEGRGDPCWQVTQQLHTLIEKSLFQRYQREISSAVRDEMSRVMPSLAMEDQA
SSRPKVAAHVTGSFAPKAPREGGGSAGRRVQGQKISWWEGHKGLAFLQDVRLIDGELVVP
CPGLYYIYAQTYFRHTHPGGEEGEEEVEEEREQRGRPMLQYVYKKVSSYPVPILLMKTSR
TSCWSRDSQFSLHSAHQGGLFPLATGDRLLVTVSNASAIDMDERSSFFGAVLVS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgactcaagtcatgtttttgttcttaaccgtggccttgcctgctcctccctctctcttt
ccctctcctccctctacctctctctttctgtgcgggaggaaggggggcagaagttatagt
tactctctcttcacagcttttgttctgaaaccggagcgtagcagagcagggcgcgaggcg
gtggtcggtatggcgggaggctcgagcggcttcacatttctcggggttctgctgctcgcg
gccattctgctgcagaccgtggccgttaccgtcaccgtgctctacttcaccaacgtcctc
aacacgatgaaggagacatttgcaaggagcagtgtgtcttgtctgacacggtctgacctc
agaggggggtatgtgcgctccccgatcgaggggagaggagacccctgctggcaggtcaca
cagcaactacacaccctcatagagaagtctctgtttcagcgatatcagagggagatctcc
tcagcagttagagacgagatgtccagggtgatgccctcactggcaatggaggaccaggct
tcttctcgccccaaagttgccgcccacgtcactggcagcttcgctcccaaagcaccgagg
gagggaggaggttctgccgggcggcgtgtgcaggggcagaagatctcgtggtgggagggg
cataaagggctggcattccttcaggatgttcgattgattgatggggagctggtggtgcct
tgcccaggactctactatatctatgcccagacctacttcagacacacccaccctggggga
gaggagggggaggaagaggtggaagaggagagggagcagagggggaggcccatgttgcag
tatgtttataagaaagtgtcttcctatccggtacccatcctgctaatgaagaccagccgt
acctcctgctggtcccgggattcccagttctctctacactcggcccaccagggagggctg
ttcccattggccacaggggaccgcctcctcgtcaccgttagcaacgcctctgccatcgac
atggatgagaggagcagctttttcggggctgtcctggtcagctag

DBGET integrated database retrieval system