KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232804Help
Entry
112232804         CDS       T05605                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like isoform X1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00590  Arachidonic acid metabolism
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    112232804
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     112232804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 112232804
NCBI-ProteinID: XP_024255800
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MRECIVCVWAFVLLLRLPTCAGEEIRDASANVVNPCCYYPCQNWGVCLRFGTDRYECDCT
RTGFYGQNCTIPEFWTRVYLKLKPSPDVVHYILTHFHWLWSLINRTFLRDWLMRVVLTVR
ANLIPSPPTFNSKYGYLSWESYSNVSYYTRILPPVPEGCPTPMGAKGKSVLPDPKLVVEK
FLLRRKFRPDPQGTNLMFAFFAQHFTHQFFKTQNSMGLGFTRALGHGVDAGHVYGDNLVR
QLNLRLLKDGKMKYQVIKGEVYPPTIAEAPVNMSYPRGVPDGQRMAIGQEVFGLLPGLTM
YATLWLREHNRVCDILKAEHPTWGDEQLFQTTRLIVIGETIRIVIEDYVQHLSGYLLDLK
FDPVLLFKSTFQYRNRIAVEFNQLYHWHPLMPDSFHIDGDVVPYSQFIFNTSIVTHYGVE
KLVDAFSRQCAGQIGGGKNIHPVVTKVAEGVIEESRALRLQPFNEYRKRFNLRPYTSFSD
FTGEEEIARELEELYGDIDALEFYPALMLEKTRPNAIFGESMVEMGAPFSLKGLLGNPIC
SPEYWKPSTFGGQTGFDIVNSASLERLVCLNTKWCPYVAFSVPPAGQEPPPRKTSTEL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgagagagtgcatcgtgtgcgtatgggcgtttgtcctgctgctaaggttaccaacatgt
gcaggggaagagatcagagacgcctctgcgaatgttgtgaatccctgttgctattacccc
tgtcaaaactggggtgtgtgtttaaggtttggcactgaccgctatgaatgtgactgcact
cgcaccggcttctatggacagaattgcactatccctgagttctggacaagggtctacctg
aagctgaagccgagccctgatgtggtccactacatccttacacacttccactggctgtgg
agcctcatcaacaggaccttcctacgggactggctcatgagggtggtcctcacagtcaga
gcaaaccttattcccagtcctcctaccttcaactcaaagtatggatacctcagctgggaa
tcctactccaatgtctcctattacacccgtatcctaccccctgtgcctgaaggctgcccc
acccctatgggtgccaaaggaaagtctgtcctcccagacccaaagctggtggtggagaag
tttctgctgaggaggaagttcaggccggatccacagggaaccaacctgatgtttgctttc
ttcgctcagcacttcacccatcagttcttcaagactcaaaacagcatgggcctgggcttc
accagggcgttggggcatggggtggatgccggccatgtctacggcgataatctggtgcgt
caactgaacctccggcttcttaaagatggaaagatgaaataccaggtaattaaaggtgag
gtgtaccctccaacgatagccgaggcgccagtgaatatgagctaccctcgaggggttccc
gacgggcagcgcatggccattgggcaggaggtgtttgggctgctgccaggcctcaccatg
tacgccaccctgtggctgagagaacacaaccgcgtctgtgacatcctgaaggccgagcac
cccacctggggggatgagcagctcttccagaccaccaggctcatcgtcataggtgagact
atccggatagtgatcgaggactacgtgcagcacctgagcggctacctgttggatctgaag
ttcgatccggtcctgctcttcaagtccacgttccagtacaggaaccgcatcgctgtggag
ttcaaccaactgtaccactggcacccccttatgccagacagcttccacatagacggagac
gtggtgccctactcccagttcatcttcaacacctccatcgtcacacactacggggtggag
aaactggtggacgctttctcacgccagtgtgctggacagataggaggtgggaagaacatc
cacccagtggtgaccaaggtggccgagggtgttattgaagagtccagggctctgcgtctc
caacccttcaacgagtacaggaagaggttcaacctgaggccctacacatctttctctgac
ttcactggtgaggaggagatagccagggagctggaggagctctatggtgacatcgatgcg
ctggagttctaccccgccctcatgctggagaagacacgccccaacgccatatttggcgag
agcatggtggagatgggggctcccttctccctgaaaggccttctgggtaacccgatctgt
tcccctgagtactggaagcccagcacgtttggaggccagacaggctttgatatagtcaac
tcagcctcgctggagagactggtgtgtctgaacactaagtggtgtccgtacgtagccttc
agtgtgcctccagctgggcaggagccgccgccaaggaaaacgtccactgaactgtaa

DBGET integrated database retrieval system