KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112266155
Entry
112266155         CDS       T05605                                 

Definition
(RefSeq) nitric oxide synthase, inducible-like
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00220  Arginine biosynthesis
otw00330  Arginine and proline metabolism
otw01100  Metabolic pathways
otw04020  Calcium signaling pathway
otw04146  Peroxisome
otw04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    112266155
   00330 Arginine and proline metabolism
    112266155
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112266155
   04020 Calcium signaling pathway
    112266155
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112266155
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     112266155
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 112266155
NCBI-ProteinID: XP_024299386
LinkDB
Position
13
AA seq 1081 aa
MEMVLQDDETKIALQTKLKKWETRASRCPLSIPVRNVKDGSSLNDMLHHQAVKNQQCTSQ
VCEGSVMTPKALMRCPKDTPLEILPQAIDLINQYYKSFKIPKIEHHLARLEEVAMEIGSC
GTYSLTMDELVFGARQAWRNAPRCIGRIQWSNLQVFDARKCKTTQDMFKSLCEHLQFATN
GGNLRSAITVFPLRKEDMRDFRVWNSQLVKYAGYQMPDGSIQGDPSSVEFTEICIRLGWK
PQYGLFDVLPLVLQVNGEDPDLYEIPPHLILEVPMEHPQYKWFQDLGLKWYALPAVSNML
MEIGGLEFPACPFNGWYMGTEIGVRDFCDYQRYNVLEEVGRRMGLETHKLSSLWKDQALV
TINVAVIYSFQKNKVTITDHHSAAESFMMHMETEFRLRGGCPADWAWLVPPMSGSLTPVF
HQEMVNYILSPFFYYQPDPWTTHVWRNGEMCLRKQQISFKAVARAALFSSSLMSRVLANR
VRCTVLYATETGKSQTLAQRLNSMLNCAFNCRLLCMEDYNFSDMEQESLLVVVTSTFGNG
DSPGNGESFKKQLFSLQYLRNKLRYCVFGLGSRMYPQFCAFAHAVDAKLEELGAERVTPT
GEGDELNGQEEAFSAWALTALKDAYKEFNIQGQLSLQLPGAERLCEAWDPLRYRVALESC
SQDHITALSTIHSKTVFPMKLKRRQNLQSPHSSRSTILVELERETSAEVMNFAPGDHVGV
FPGNLPQLVAGILKFLPHTAPTNQCLRLEYRSDSYDEKNWQTVRRIPACPLSQALTYFLD
VTTPPCQNLLHKLSQLARLEGHCQRLLTLAKDSQEYMTWKMFRVPNFLEVLEEFPSLEPS
AAFLLSQLPLLKPRLYSISSSPQLHPNELHLTLTVLNYHTQDGQGPLHHGVCSTWLDTIK
KGDLVPCFIYSSGGFHLPAEPSTPVILVGAGSGIAPFRSFWQQRLHDMKHPGFSGSPMSL
VFGCQSSETDHLYKEETLEMRRKGVLKSVTTYSRQPGHPKIYVQDVLREKMAGEVLSVLH
QKEGHFYVCGGVNMAQGVTLAVQEILSSQLGITLTQAGEYLTQLKIQKRYHEDIFGAQFQ
K
NT seq 3246 nt   +upstreamnt  +downstreamnt
atggagatggtgcttcaagatgatgaaaccaaaatagctctccagactaaacttaagaag
tgggaaacaagagcaagcaggtgtccgttgtctatacctgtgcgtaatgtgaaggatggc
tcaagtctcaatgatatgctgcaccaccaggcagttaagaaccaacaatgtacatcacaa
gtttgtgaaggttctgtcatgactcccaaggctctaatgcgctgtcccaaagatactcct
cttgagatcctacctcaggcgattgacctaatcaaccaatactacaagtccttcaaaatc
cccaaaattgaacatcaccttgccagattggaggaagttgctatggagataggttcctgt
ggaacttattcgctgactatggacgaattagtgtttggtgctcgacaagcatggaggaac
gccccaagatgcatcggcaggattcagtggtccaatttacaagtgtttgatgccagaaag
tgcaagactactcaggatatgttcaagtctctgtgcgaacacttacagtttgccacaaat
ggaggaaacctaaggtctgcgattaccgtcttccctctgagaaaggaagacatgcgagat
ttccgggtgtggaacagccagctggtgaagtatgcaggttaccagatgcctgatggcagt
atccagggagacccatccagtgtagaattcactgagatctgtatccggcttggatggaaa
cctcagtacggcctcttcgatgtattgccactagtcctgcaggtcaatggggaggaccca
gacctttatgaaatccctccacacctgatcctggaggttcccatggaacaccctcagtat
aagtggttccaagacctaggactgaagtggtatgctctgcctgcggtgtccaacatgctg
atggagattggtggacttgaattcccagcctgtccctttaatggctggtacatgggcact
gaaattggtgtgagggatttctgtgactatcagcgttataacgtcttggaggaagttggt
cgcaggatgggcctggagacacacaagctgtcctcactgtggaaggaccaggccttggtg
accatcaatgttgcagtcatatacagtttccagaagaacaaggtgaccatcacagaccac
cactctgcagccgagtcctttatgatgcacatggagacagagttccggctgcgtggcggc
tgccctgcagactgggcctggctggttcctcccatgtctggctctctcacccctgtcttc
caccaggagatggtcaactacatcctctctcccttcttctactaccagcctgacccctgg
acgacccatgtctggagaaatggggagatgtgcctgaggaaacaacagatcagcttcaaa
gcggtggccagggcggctctcttttcttcaagccttatgagcagagtgctggctaacagg
gtgcgttgcactgtcctgtacgctactgaaacagggaaatcacagacattggcccagaga
ctgaactccatgctaaactgtgccttcaattgcaggttgctctgtatggaggactataac
ttcagtgacatggaacaggagagtcttctggttgtggtaacaagcacatttgggaatgga
gactcccctggaaatggagagagtttcaagaagcagcttttctccttgcagtatctcagg
aacaagttaaggtactgtgtgtttggactgggctcgaggatgtacccacagttctgtgct
ttcgcccatgccgtggatgccaagctggaggagctgggggcagagcgggtgacgcccact
ggagagggggatgaactgaatggacaggaagaggccttctctgcctgggctctcaccgct
ctcaaggatgcctataaggagttcaacatccagggacagctgagtctgcagctccctggg
gcagagcgactctgcgaggcctgggaccctttgagatatcgcgtagcactggagagctgc
tcccaggaccacatcacagcactttcaaccattcactctaaaactgtcttccccatgaaa
ctgaagaggagacagaatctacagagcccccattcaagccggtccaccattctggtggag
ctggagagggagacaagtgcagaggtcatgaactttgccccaggagaccatgttggtgtt
ttcccagggaatctccctcaactggtggctggaatcctaaagttccttccccatacagcc
ccaaccaaccagtgcctacgactggaataccgctctgactcctatgatgagaaaaactgg
cagactgtcagacgcatcccagcatgccctttgtctcaggcactcacctacttcctggat
gtgaccacgcccccctgtcagaacctcctccacaagctctctcagctggcaagactggag
gggcactgccagcgtctgctgaccttggcaaaggactctcaggagtacatgacctggaag
atgttccgtgttcccaacttcctggaagtcctggaggagttcccgtctttagaaccctct
gcagccttcctcctcagccagctgcccctgctcaagccccgcctctactccatcagctcc
tcccctcaactccaccccaatgagctacatctcactctgacggtgctcaactatcacaca
caagatggacagggtcctcttcaccacggggtctgcagcacctggctggataccattaag
aaaggagacctggtaccatgtttcatctacagttcaggtgggttccacctcccagcagag
cccagcactccagtcattctggtgggggctggcagtggcatcgcgcccttccgaagcttc
tggcaacaacggctacatgacatgaaacacccagggttctctggaagtcctatgagcctg
gtgtttggctgccagagttcagagacagaccatttatacaaagaggagacactggagatg
agaagaaaaggggtcctgaagagtgttaccacatattcccgccagccaggtcacccaaag
atctatgtccaggatgtcctgagggagaagatggcaggggaggtgctgagtgtgttgcac
cagaaggagggtcacttctacgtgtgcgggggtgtgaacatggcccagggagttactcta
gcagtacaggagattctgagcagccagcttggcatcaccctcacacaggcaggagaatac
ctgacccaactaaagattcagaagaggtaccatgaggacatttttggagcccagtttcaa
aagtga

DBGET integrated database retrieval system