KEGG   Cutibacterium acnes C1: PAC1_09275Help
Entry
PAC1_09275        CDS       T02330                                 

Definition
(GenBank) tRNA (guanine-N(7)-)-methyltransferase
  KO
K03439  tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Organism
pacc  Cutibacterium acnes C1
Brite
KEGG Orthology (KO) [BR:pacc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pacc03016]
    PAC1_09275
Enzymes [BR:pacc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.33  tRNA (guanine46-N7)-methyltransferase
     PAC1_09275
Transfer RNA biogenesis [BR:pacc03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    PAC1_09275
 Prokaryotic type
    PAC1_09275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_4 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AFU41604
LinkDB All DBs
Position
1946118..1947029
Genome map
AA seq 303 aa AA seqDB search
MDRRSITSAGVHFNHRVAQSHRLSFDPVRPDPAPLDPTDASPAQARRHQPGLGVEVSAGA
HRSGDRVRRGVVSFVRRSPRMNVSQQRAMNTLASTYLIDVPRDATSTSVAPGSRLDLPAI
FGRTAPLTVEIGVGSGDVLAALAAAHPERDFIGFEVYLPSIATTLNKLENAGAGNARVIM
ADATAGLEHLFGPADLDELWTFFADPWHKKRHHKRRIVNPDTARLVTSRLRPGGLWRLAT
DWDDYAHWMLEVLSAEPLLKPVDAGPDGFSPRWPERPVTRYENKGLTAGRTIHDLTWRRV
DGS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgccgctccatcacttcagccggcgtacacttcaatcaccgcgtcgctcagagt
catcgactatcattcgaccccgtgcgacccgaccccgctcccctcgatccgaccgacgct
tcccctgcccaggctcgccgccatcagccggggctaggggtcgaggtgtcagccggggcg
caccgctcgggcgaccgggtccggcgcggtgtcgtctccttcgtgcggcgatccccccgg
atgaacgtctctcagcaacgagccatgaataccttggccagcacgtacctcatcgacgtc
ccccgcgacgccaccagcacctcggtcgcacctggatcccgtctagacctccccgcgatc
ttcggtcgcaccgccccgcttaccgtagagatcggagttgggtctggcgacgtgctggca
gcgctagcggccgcccatcccgagcgagacttcatcggtttcgaggtctacctgccctcc
atcgcgacgaccctcaacaagctcgagaacgctggcgcaggtaacgcccgggtcatcatg
gccgatgccacagcagggctggaacacctcttcggacccgccgacctcgacgaattgtgg
accttcttcgctgatccatggcacaaaaagcgtcaccacaaacgtcgcatcgtcaacccc
gacacagcccgtctggtgacgtcccggctgcgtccgggcggtctgtggcgtctggccacc
gactgggacgactacgcccactggatgctcgaagtactctcagccgagccgctgctcaag
ccggtcgacgctgggccggacggttttagcccgcgctggcccgaacggccggtgacccgt
tacgagaacaaggggctgacggccggacgcaccattcacgacctcacctggcgtcgcgtg
gacgggtcatga

DBGET integrated database retrieval system