KEGG   Propionibacterium acidifaciens: EGX94_06655Help
Entry
EGX94_06655       CDS       T05713                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pacd  Propionibacterium acidifaciens
Pathway
pacd00010  Glycolysis / Gluconeogenesis
pacd00030  Pentose phosphate pathway
pacd00051  Fructose and mannose metabolism
pacd00052  Galactose metabolism
pacd00680  Methane metabolism
pacd01100  Metabolic pathways
pacd01110  Biosynthesis of secondary metabolites
pacd01120  Microbial metabolism in diverse environments
pacd01130  Biosynthesis of antibiotics
pacd01200  Carbon metabolism
pacd01230  Biosynthesis of amino acids
pacd03018  RNA degradation
Module
pacd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pacd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EGX94_06655
   00030 Pentose phosphate pathway
    EGX94_06655
   00051 Fructose and mannose metabolism
    EGX94_06655
   00052 Galactose metabolism
    EGX94_06655
  09102 Energy metabolism
   00680 Methane metabolism
    EGX94_06655
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    EGX94_06655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pacd01009]
    EGX94_06655
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pacd03019]
    EGX94_06655
Enzymes [BR:pacd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EGX94_06655
Protein phosphatases and associated proteins [BR:pacd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EGX94_06655
Messenger RNA biogenesis [BR:pacd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EGX94_06655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AYW77795
LinkDB All DBs
Position
1599910..1602138
Genome map
AA seq 742 aa AA seqDB search
MTDTAAASPARLAVLTSGGDAQGMNAAVRGVARTAMSRGAEVFAVYEGYQGLVDGGDAIR
RFAWGDAGNILGRGGTSIGTFRSKEFRTRQGRLKAAKNLVERGIDRLVVIGGDGSLTGLD
AFRAEWPGLMDELADAGLISPEMAAAHPALMIAGLVGSIDNDLVGTDTTIGADSALHRIV
DAIDAITATAASHQRCFVIEVMGRHCGYLALMSAIAGGADYVLIPELPPADGWEEQMCAE
LRRGRAAGRRESIVVVAEGAQDRTGEPITSEYVRATISRINGEDARLTNLGHVQRGGKPS
AYDRWASTWLGYSAALEALTAGPATEGVVLGIRGSEIVRLPLAEAVARTRRVPELIAAGD
YDAAMGLRNEDFTDMARIFTELTHPNRVTTKEDSPRVAILHAGGLAPGMNTAARAAVRLG
IARGHTMLGVRNGFTGLLRGAVDELGWEDVEGWTGVGGAELGLRRDVPGVEQFYAISRAL
EDHRVDALMVIGGWNAYQAAHLMQGEADRYPAFRIPIVCVPATIDNNLPGSDETIGADSA
LNEIVDDIDRIKQSAAATTRCFVVETMGRHCGYLALMGGLAGGAERIYLDEDGIGLDQLN
QDVRWLRDSFGRGRRLFLAVRSERASESYTTDFLGRLFEGESHGLYDVRTNIIGHVQQGG
EPSPADRLLATRMAAAALDVLARELGADEPTARYLGLRGGRIEDHPLAHMTEYVNSVKRR
PRTQWWMELRPVVAAVGREPSS
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccgctgccgccagcccagcccgcctcgccgtgctcacctccggcggtgac
gcgcagggcatgaacgctgccgttcgcggtgtcgcgcgcactgcgatgagtcggggcgcc
gaggtcttcgccgtctacgagggctaccagggtctcgtcgacgggggcgacgcgatccgg
cgcttcgcatggggggacgccgggaacatcctgggccggggcggcacgtccatcggcacc
ttccgctcgaaggagttccgcacccggcagggccgtctcaaggccgcgaagaacctggtg
gagcgcgggatcgaccgtcttgtcgtgatcggcggcgacggttcgctgaccggcctggac
gccttccgcgccgaatggcccgggctcatggacgagctggccgacgcggggctcatcagt
cccgagatggccgccgcgcacccggccctcatgatcgccggcctggtcggctcgatcgac
aacgatctcgtcggcaccgacacgacgatcggggccgactccgccctgcaccgcatcgtc
gacgcgatcgacgccatcaccgccaccgccgccagtcaccagcgctgcttcgtcatcgag
gtcatgggtcgccactgcggctacctggcgctcatgagcgccatcgccggcggtgccgac
tacgtcctcatccccgagctgccgccggccgacggctgggaggagcagatgtgcgccgag
ctgcgccgcggccgggccgcgggccggcgcgagtcgatcgtcgtcgtcgccgagggggcg
caggaccgcacgggcgaaccgatcacgagcgagtacgtgcgcgcgacgatcagccgcatc
aacggcgaggacgcccgcctgacgaacctcggccacgtgcagcgcggcggaaagccgagc
gcctacgaccgctgggccagcacctggctcggctactcggcggccctcgaggcgctcacc
gcgggccccgccaccgagggcgtcgtcctgggcatccgaggctcggagatcgtgcgtctg
cctctggccgaggcggtcgcgaggacccgacgggtgcccgagctcatcgcggccggcgac
tacgacgccgcgatgggcctgcgcaacgaggacttcaccgacatggcgcggatcttcacc
gagctcacccacccgaaccgggtcacgacgaaggaggactccccgcgcgtggcgatcctg
cacgccggtggcctggccccgggcatgaacacggcggcccgagccgcggtgcgtctgggc
atcgcccggggccacaccatgctgggcgtgcgcaacggcttcaccgggctgctgcgcggc
gcggtcgacgagctcggctgggaggacgtcgagggctggaccggcgtcggcggcgcggag
ctcggtctgcgccgcgacgtgccgggcgtcgagcagttctacgcgatcagccgggcgctg
gaggaccaccgggtggacgccctcatggtgatcggcggctggaacgcctatcaggcggcc
cacctcatgcagggcgaggccgaccgctacccggccttccgcatcccgatcgtctgcgtg
ccggcgaccatcgacaacaacctgcccggcagcgacgagaccatcggcgccgactccgcc
ctcaacgagatcgtcgacgacatcgaccgcatcaagcagtcggcggcggccacgacgcgc
tgcttcgtcgtcgagacgatgggccgccactgcggctacctcgcgctcatgggcggcctg
gccggcggggccgagcgcatctacctcgacgaggacggcatcggcctcgaccagctcaac
caggacgtgcgctggctgcgcgactccttcggccgggggcgccgcctgttcctcgcggtg
cgctccgagagggcctccgagtcgtacacgaccgacttcctggggcgcctgttcgagggc
gagagccacggcctgtacgacgtgcggacgaacatcatcgggcacgtgcagcagggcggc
gagccgagccccgccgaccggctgctcgccacgcggatggccgcggcggccctcgacgtg
ctggcccgcgagctcggcgccgacgagccgacggcccgctacctcggcctgcgcggcggc
cggatcgaggaccacccgctggcgcacatgaccgagtacgtcaacagcgtgaagcgccgc
ccccgcacgcagtggtggatggagctccgtccggtcgttgcggcggtgggcagggagccg
tcctcgtga

DBGET integrated database retrieval system