Pigmentiphaga aceris: FXN63_02670 Help Entry FXN63_02670       CDS       T06198                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism pacr  Pigmentiphaga aceris Brite KEGG Orthology (KO) [BR:pacr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pacr03110]     FXN63_02670 (grxC) Chaperones and folding catalysts [BR:pacr03110]  Protein folding catalysts   Protein disulfide isomerase    FXN63_02670 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_3 HrpB4 Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  QEI04867 UniProt:  A0A5C0AX08 LinkDB All DBs Position 644355..644615 Genome browser AA seq 86 aa AA seqDB search MSKVLMYSTGVCPYCTRAEMLLKQRGVTEIEKVRIDIEPARREEMMTRTGRRTVPQIYIG ETHVGGFDDLAALDRAGGLQPLLDAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcaaggtattgatgtattcgaccggcgtctgtccgtattgcacccgcgccgaaatg ttgctcaagcagcgcggcgtgaccgagatcgaaaaggttcgcatcgacatcgaaccggcc cgccgcgaagaaatgatgacgcgcaccggtcgccgcaccgtgccgcagatctacatcggc gagacccatgttggtggcttcgacgacctggccgcactcgaccgtgcaggtggcttgcag cccctgctggatgccgcctga

DBGET integrated database retrieval system