Paraburkholderia acidisoli: FAZ98_01195 Help Entry FAZ98_01195       CDS       T07287                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism pacs  Paraburkholderia acidisoli Brite KEGG Orthology (KO) [BR:pacs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pacs03110]     FAZ98_01195 (grxC) Chaperones and folding catalysts [BR:pacs03110]  Protein folding catalysts   Protein disulfide isomerase    FAZ98_01195 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  QGZ60460 UniProt:  A0A7Z2GF91 LinkDB All DBs Position 1:278747..279010 Genome browser AA seq 87 aa AA seqDB search MNKVVMYSTQVCPYCQMAERLLKSRGVEHIEKVLIDRDPARREEMMTRTGRRTVPQVFIG ETHVGGYDDLSALDRAGGLTPLLEAAA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaggttgtgatgtatagcacccaggtgtgcccgtattgccagatggccgaacgt cttttaaagtcgcgcggcgtcgagcacatcgaaaaggtgctgatcgaccgggacccggcg cggcgcgaagagatgatgacgcgcaccggccggcgcaccgtgccgcaggttttcatcggc gagacgcatgtgggcggttacgatgacctctccgcgctcgaccgcgcgggcggcctcacg ccgctgctcgaagccgccgcttga

DBGET integrated database retrieval system