KEGG   Pygoscelis adeliae (Adelie penguin): 103920669
Entry
103920669         CDS       T06012                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl00480  Glutathione metabolism
padl00980  Metabolism of xenobiotics by cytochrome P450
padl00982  Drug metabolism - cytochrome P450
padl00983  Drug metabolism - other enzymes
padl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:padl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103920669 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103920669 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    103920669 (GSTO1)
   00983 Drug metabolism - other enzymes
    103920669 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:padl02000]
    103920669 (GSTO1)
Enzymes [BR:padl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103920669 (GSTO1)
Transporters [BR:padl02000]
 Other transporters
  Pores ion channels [TC:1]
   103920669 (GSTO1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C GST_C_5 GST_N_4 Glutaredoxin
Other DBs
NCBI-GeneID: 103920669
NCBI-ProteinID: XP_009326719
LinkDB
Position
Unknown
AA seq 214 aa
MRFCPFAQRTRLVLRAKGISHEIININLKNKPDWFFEKNPFGLVPVLETSKGQLIYESPI
TCEYLDEAFPGKKLMPSDPYERAFQKMILEHFSKITPIVFKYFVAVKDGQDTTALKAEIA
EKFGKLEEILSKRNTVFYGGDSISMLDYMIWPWFERLEPLQLKDSLSHTPKLQRWMEAMK
EDPAVKATMTDPQTFKDYLQLYSKNSPEACDYGL
NT seq 645 nt   +upstreamnt  +downstreamnt
atgcggttctgccccttcgcccagaggacgcgcctcgtcctccgcgccaagggcatcagc
catgaaataatcaacatcaatctgaagaacaaacctgactggttctttgagaagaacccc
tttgggctggttcctgttctggaaaccagcaagggccagctgatctatgagtccccaatc
acttgtgagtatttggatgaagcatttccagggaagaagttgatgccttcggacccatat
gagcgagcctttcagaagatgatcttggaacacttctcaaagataacacccatagttttc
aagtattttgtggcagtcaaagatggacaggacaccacggcgctgaaagcagagattgct
gaaaagtttggcaaacttgaagagattctgtccaaacgcaacactgtgttttacggtggg
gactcaatctccatgcttgactacatgatctggccgtggtttgaacgtctggaaccattg
cagctgaaggactctttgagtcacaccccaaagctccaacgctggatggaggccatgaag
gaggaccctgctgtcaaggctacaatgactgacccacagacattcaaagattatctccag
ctctattcgaagaacagccctgaggcatgtgattatgggctctga

DBGET integrated database retrieval system