KEGG   Pygoscelis adeliae (Adelie penguin): 103923309Help
Entry
103923309         CDS       T06012                                 

Gene name
PTGS1
Definition
(RefSeq) LOW QUALITY PROTEIN: prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
padl  Pygoscelis adeliae (Adelie penguin)
Pathway
padl00590  Arachidonic acid metabolism
padl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:padl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103923309 (PTGS1)
Enzymes [BR:padl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103923309 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 103923309
NCBI-ProteinID: XP_009329889
LinkDB All DBs
Position
Unknown
AA seq 568 aa AA seqDB search
SLPAVNPCCYFPCQHQGVCMRVGLGGYECDCTRTGYFGANCTSPEFWTRLHDLLKPSPAF
FHFILTHFRWFWDIINSTFIRDTLMRLVLTVRANLIPSPPTFNSDYGYITWEAYANVSYY
TRVLPPVPDNCPTPMGTKGKKQLPDPQLLAERFLLRQKFEADPQGTNLMFAFFAQHFTHQ
FFKTSGKMGRGFTKALAHGVDLGHLYGDNLQRQHQLRLFRDGKLKFQVVDGEVYPPMVTD
APVHMVYPSAVPKEKQLAMGQEVFGLLPGLCMYATLWLREHNRVCDILKREHPTWSDEQL
FQTARLILIGETIKIVIEDYVQHLSGYFLSLKFDPELLFGTQFQYRNRIAVEFNQLYHWH
GLMPDSFVIQGEEYNYEQFLYNTSMLMDYGVEALVESFSKQTAGRIGGGQTINANILKVA
VGVIQESRQLRLQPXKRFGMKPYKSFQELTGEEEKAAELEELYGDIDALEFYLGLLLEKP
QPNGIFGESMVEIGAPFSLKGLLGNPICSPEYWKPSTFGGATGFEIVKTASLKKLVCLNV
KKCPYVAFHVPDAAENGSPRAGGPSTEL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
tctctccccgcagtgaatccctgttgctatttcccctgccagcaccaaggggtgtgcatg
agggtcggcctgggaggatacgagtgcgactgcacgcgcacgggatacttcggggccaac
tgcacctcccccgagttctggacgcgcctccacgacctgctgaagcccagtcctgccttc
ttccacttcatcctgacccacttcaggtggttttgggatattatcaacagcaccttcatc
agggacacgcttatgaggctcgtgctcacagttcgtgccaatctcatccccagccccccc
accttcaactctgactatggctacatcacgtgggaggcctacgccaatgtcagctattac
acccgtgtcctcccgcccgtgccggacaactgcccaacgcccatggggaccaaagggaag
aagcagctccccgacccccagctcctggcggagaggttcctgttgcggcagaagtttgaa
gccgatccccaaggcaccaacctgatgtttgccttcttcgcccagcatttcacccaccag
ttcttcaagacgtccgggaagatgggacgtggcttcaccaaggcgctggcgcatggggtg
gacctcgggcacttgtacggggacaacctgcagcggcagcaccagctgcgactcttcaga
gacgggaagctgaaattccaggtggtggatggagaggtgtacccccccatggtcaccgat
gctccggtccacatggtctacccgtctgccgtccccaaggagaagcagctggcgatgggg
caggaggtgtttgggctgttgccgggactctgcatgtatgccacgctctggctgcgcgag
cacaaccgtgtctgcgacatactgaaacgggagcatcccacctggagcgacgagcagctc
ttccagacagctcgtctcatcctcatcggggagaccattaagattgtcatcgaagactac
gtccagcatctcagtgggtacttcctcagcctcaagttcgaccccgagctgctgtttggg
acgcagttccagtaccggaatcgcatcgcggtggagttcaaccagctctatcactggcac
ggtctgatgcccgactccttcgtcatccagggggaagagtacaactacgagcagttcctc
tacaacacctccatgctcatggactatggcgtggaggcgctggtggagtccttttccaag
cagactgcaggaaggatcggtgggggacaaaccatcaatgctaacatcttgaaagtggcc
gttggggtcatccaggaatcccggcagctgaggctacagccgnngaagaggtttggcatg
aagccctacaagtcctttcaggagctaacaggagaggaagagaaggcggcagagctggaa
gagctgtatggagacattgatgctctggagttttatctgggcttgctgcttgagaaaccc
caacccaatggtatttttggagaaagcatggtggagatcggagctccgttttccctgaag
gggcttcttggaaaccccatctgctccccagagtactggaaacccagtacattcggtgga
gcaactggctttgagatagttaagacagcatcactcaagaaactcgtgtgcctcaatgtg
aagaagtgcccgtacgtggcgtttcatgtgccggatgctgcggaaaatggcagccctcgg
gctggtggaccatctactgagctgtag

DBGET integrated database retrieval system