KEGG   Pseudomonas aeruginosa PAO1: PA4153Help
Entry
PA4153            CDS       T00035                                 

Definition
(RefSeq) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PA4153
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PA4153
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PA4153
    1.1.1.-  
     PA4153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C DAO Pyr_redox_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 880134
NCBI-ProteinID: NP_252842
UniProt: Q9HWM8
LinkDB All DBs
Position
4646720..4647811
Genome map
AA seq 363 aa AA seqDB search
MNSSPQANAAMRAAVWHGRHDIRVEDVPLPAEPPPGWVQIRVHWCGICGSDLHEYLAGPV
FIPVEAPHPLTGLKDQCILGHEFSGEIVRLGNGVTGFAVGQAVAADACQHCGTCYYCRHG
LYNICENLAFTGLMNNGAFAEYVNVPANLLYALPAGFPSEAGALIEPLAVGMHAVKKAGS
LLGQNVVVVGAGTIGLSTIMCARAAGAAQVIALEMSSARKAKALEVGASQVLDPSRCDAL
GEIRALTGGLGADVSFECIGNKHTAKLAIDAIRKAGKCVLVGIFEEPSEFNFFELVSTEK
QLLGALAYNGEFADVIAFIADGRLDIAPLVTGRIGLEEIVERGFEELVNNKEHNVKIIVS
PGG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaacagttccccgcaagccaacgcggcgatgcgcgccgccgtctggcacggccgccac
gatatccgcgtggaagacgtgccgctcccggccgagccgccgcccggctgggtgcagatc
cgcgtgcactggtgcggcatctgcggctccgacctgcacgaatacctggccggcccggta
ttcatccccgtggaggcgccgcacccgctcaccggcctcaaggatcaatgcatcctcggc
cacgagttcagcggcgaaatcgtccgcctcggcaacggcgtgaccggcttcgccgtcggc
caggcggtcgccgcagacgcctgccagcattgcggcacctgctactactgccggcatggg
ctgtacaacatctgcgagaacctggccttcaccgggctgatgaacaacggcgccttcgcc
gaatacgtcaacgtaccggccaacctgctctacgccctgccggccggatttcccagcgag
gccggcgcgctgatcgagccgctggcggtgggcatgcacgcggtgaagaaggccggcagc
ctgctcgggcagaacgtggtggtggtcggcgccggcaccatcggcctgagcaccatcatg
tgcgcgcgcgccgccggcgcggcacaggtgatcgccctggagatgtcctcggcgcgcaag
gccaaggccctggaggtcggcgccagccaggtgctcgacccctcgcggtgcgacgcccta
ggcgaaatccgcgccctcaccggcgggcttggcgccgacgtcagcttcgaatgcatcggc
aacaagcacaccgccaagctggccatcgatgccatccgcaaggccggcaaatgcgtgctt
gtgggaatcttcgaggagcccagtgaattcaatttcttcgagctggtttccaccgagaag
cagttgctcggggccctcgcctacaacggcgagttcgccgacgtgatcgccttcatagcc
gacggccgcctcgacatcgcaccgctggtgaccggtcgcatcggcctggaagaaatcgtc
gagcgcggtttcgaagagttggtgaacaacaaggagcacaacgtgaagatcatcgtctcg
ccgggcggctga

DBGET integrated database retrieval system