KEGG   Paenibacillus sp. FSL R7-0273: R70723_24115
Entry
R70723_24115      CDS       T03356                                 

Definition
(GenBank) sugar phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
paea  Paenibacillus sp. FSL R7-0273
Brite
KEGG Orthology (KO) [BR:paea00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    R70723_24115
Enzymes [BR:paea01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     R70723_24115
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AIQ48650
UniProt: A0A089KLE9
LinkDB
Position
5377167..5378636
AA seq 489 aa
MPLKNQVQLITYPDSLGGDLKGLKEVLYSRFADLFKGGVHILPPFPSSGDRGFAPLTYLE
IDPKFGTWDDIREIGEQFDVLVDLMVNHISQKSEYFQDFLKSGRSSQYADLFLTLDKLWE
DGKPVQQDIDKMFLRRPLPYSTFQIGDNGTEESVWTTFGKTDPSEQIDLDIGSEMTKQLL
ASFFRNFKKYNIKIVRLDAVGYVIKKLGTSCFFVEPEVYDFLDWIMELAQSLDIELLPEV
HSHHSIQYKLAEHGYWIYDFILPYRILEAITNRSSAALCDYLQTRPAKQFTMLDCHDGIP
VKPDLDGLLDTGEAKKLVDTCIERGSNLSLILSEEHKGEDGFDVHQIRCTYYSVLDSDDD
SYLAARAIQFFAPGIPQIYYVGLLAGENDYERAEESGDGREINRQNYTLEEIDQSLQKPV
VQRLLKLIRFRNSYAAFDGKFEVKVSSTEEVRLRWDNNDQYCELLIDLNTKRTTIQYIDD
HNSVIEYTV
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgccattaaaaaaccaggttcaattgataacttatcccgactcactgggcggagattta
aaagggctgaaggaggttctctattcccggttcgctgacctctttaaaggcggcgtgcat
attctccctccattcccttcttcgggcgacagaggttttgccccgcttacttacctcgaa
attgatcccaaattcggaacatgggatgatatccgggagatcggagaacaatttgatgtc
ctcgttgatttgatggtcaatcatatttcacagaaatcagaatacttccaggacttcctg
aagtccggccgcagctcacaatatgcagacctgttcctcaccctggataagctctgggaa
gacggaaagccagtgcagcaagatatagacaagatgtttttgcgcagacccttgccctac
tctaccttccagattggggataatggtacagaggaaagcgtatggaccacttttggaaaa
acagacccttcagagcagattgacctggacatcggctctgaaatgacaaaacagctcctg
gcctccttcttccgtaatttcaaaaaatataatatcaaaattgtccgtctggatgcggtg
ggatacgttattaagaagctgggaaccagctgtttctttgttgagccggaggtttatgat
tttcttgactggatcatggagcttgcccaatccctggacattgagctgcttccagaggtg
cactcccatcactccatccagtataaattggcagagcacggttactggatttatgatttt
atattaccgtaccgcattctggaggccatcaccaaccgttccagcgcagcgctatgtgat
tatttgcagacccggcctgctaaacaattcacaatgctagattgtcatgacggtatccct
gtcaaaccggatttggacggcctgctggatacgggggaggcgaaaaagctcgtagatacc
tgtattgagaggggctctaatctgagcctgattctgtcggaagagcataagggtgaggat
ggcttcgatgttcatcaaatccgctgtacctattattccgtacttgatagcgatgatgat
tcctaccttgctgcaagagccattcaatttttcgctccgggtattccgcagatatattat
gtaggactgcttgccggtgaaaatgattatgaacgggcagaagaaagcggagacggccgt
gagattaaccgtcagaactatacccttgaagaaatcgaccaatccttgcaaaaacctgtc
gtacagcgtcttctaaagcttatccggttccgtaacagctatgcggcatttgacggtaag
tttgaagttaaggtatcatcaacggaagaagtcaggctgcgctgggataataatgaccaa
tactgcgaactgctcattgaccttaataccaagcgaaccactattcaatacattgatgat
cataacagcgtgattgaatatactgtctga

DBGET integrated database retrieval system