KEGG   Paenibacillus sp. FSL R5-0345: R50345_26895
Entry
R50345_26895      CDS       T03333                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase
Organism
paef  Paenibacillus sp. FSL R5-0345
SSDB
Motif
Pfam: FAD_binding_2 Pyr_redox_2 DAO FAD_oxidored HI0933_like GIDA Succ_DH_flav_C FAD_binding_3 AlaDh_PNT_C Dot_icm_IcmQ NAD_binding_8 Thi4
Other DBs
NCBI-ProteinID: AIQ37917
LinkDB
Position
complement(5941388..5942998)
AA seq 536 aa
MSQLKKEMTVDVLVLGGGPAGAWAAWSAASQGAKVVLADKGYLGTSGATAPGGTTLLVIP
PIAELREQAVQSRLKSGGYLSENAWIHRVLDQVEQNLALVEQWGYPFPKDEAGNSLRTHL
HGPEYMRIMRRVVRKAGVTILDQSPALELLYDEHGVGGARGINRLTGESWEVKANAVVMA
TGGCAFLSKGLGCNVLTGEGLLMSAEVGAELSGMEFSRQYAPSFADGTVTRGRMLAWATL
YDADGHPLHKGDRTFGSIPEMMLKAPVYASLDMADTAEKQDFLRKAHPIFFMPLERAGID
AFKQKFPLTLRYEGTMRGTGGLRLSGTDCRTTVPGLYAAGDAASREKVTGAISGGGAYNA
SWAICSGSWAGQGAAQHTRSCRGQANSRNLTAAGRYGLAAGADTSETLEVKPLVAAIQRE
ILPLQINYFRSEPGISSALKRLNALMPFLNGRVPATVQGIVQAREAAAMLAAGRWMYTAA
LARKETRGLQKLAEYPELDPRQTHRLIVSGIEQISIGTEAVPHAHELNLLKEGQAI
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgtcgcagcttaagaaggaaatgacagtggatgtcctcgtgcttggaggaggccccgca
ggtgcttgggcggcatggagtgcagcgtcgcaaggtgcaaaggtagtcctggccgataag
ggctacttgggcacaagcggggctactgctccaggcggtacaacgctgctcgttatccca
ccgattgccgaactgcgagagcaggcggttcaatccaggctgaaatccggtggatatttg
tcggagaatgcttggattcaccgagtgctggatcaggtagagcagaatctggctctagtc
gagcagtggggttatccttttccaaaggatgaggcaggcaactcacttcgtacacatctg
catggaccagaatacatgcggattatgcgaagggttgtccgcaaagcgggggtcacgatc
ctcgatcagtcgccagcgctagagcttctttatgatgaacatggggttggcggtgcacgt
ggaatcaaccgtctgacaggggagtcttgggaagtgaaggctaatgccgtagtgatggca
accggtggctgcgcttttctcagcaaaggtcttggctgcaacgtactgacaggcgaaggg
ctgctgatgtctgctgaagtgggagccgagctgtcgggtatggaattcagccgccaatac
gcgccgagcttcgcggatggaaccgtaacccgcggccgtatgctggcgtgggcaacgctt
tatgacgcggacggtcatccgctgcataaaggggatcggacttttggcagcattcctgaa
atgatgctcaaagctccggtttatgcttcgctcgatatggcagatacagcggagaaacag
gattttctgcgaaaagcgcatccgattttctttatgccgctggagcgggcggggattgat
gcgtttaagcagaaattcccgctcacactgcgctatgagggaaccatgcgcggaactggg
gggttgcgcttgagcggcacggactgccggacgaccgtgcccggactttatgcggccgga
gatgccgcatctcgcgagaaagtgaccggcgccatctccggcggcggggcttacaacgct
tcctgggccatatgcagcggaagctgggcaggccagggagccgcgcagcatacgcggtcc
tgccgagggcaggcgaacagccgcaaccttaccgcagcgggacgctacggtctggcggct
ggcgccgacacctcggagacgctggaggtgaagccgctagtcgcggcgatccagcgtgaa
atcttaccgctgcagattaattatttccgcagcgagccgggcatttcttcagccttgaag
cggctgaatgccttgatgcccttcttgaacgggcgggtccccgccaccgtacagggcatc
gtgcaagcgcgtgaagccgcggctatgctcgcggccggcaggtggatgtacaccgccgca
ctggctcggaaggagacgcgcggcctgcaaaagctcgcggaatatccggagcttgatccg
cgtcaaacccaccggctgattgtatccggtatagagcaaataagcatcggtaccgaagct
gtgccccatgctcatgaactgaatctactaaaggaggggcaggcgatatga

DBGET integrated database retrieval system