KEGG   Pseudomonas aeruginosa YL84: AI22_25005Help
Entry
AI22_25005        CDS       T03035                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
paeg  Pseudomonas aeruginosa YL84
Pathway
paeg00730  Thiamine metabolism
paeg00790  Folate biosynthesis
paeg01100  Metabolic pathways
paeg02020  Two-component system
Module
paeg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:paeg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AI22_25005
   00790 Folate biosynthesis
    AI22_25005
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AI22_25005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paeg04147]
    AI22_25005
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:paeg00537]
    AI22_25005
Enzymes [BR:paeg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AI22_25005
Exosome [BR:paeg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AI22_25005
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:paeg00537]
 Enzymes
  AI22_25005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: AHH52095
LinkDB All DBs
Position
5400954..5402384
Genome map
AA seq 476 aa AA seqDB search
MTPGYPLALSLAVSMAVLGSALPAQARQDDPSLFNRQARGELSEYGGARRVEQDLTQALK
QSLSKKKAKNVILLIGDGMGDSEITVARNYARGAGGYFKGIDALPLTGQYTHYSLHKDSG
LPDYVTDSAASATAWTTGVKSYNGAIGVDIHEQPHRNLLELAKLNGKATGNVSTAELQDA
TPAALLAHVTARKCYGPEATSKQCPSNALENGGAGSITEQWLKTRPDVVLGGGAATFAET
AKAGRYAGKTLRAQAEARGYRIVENLDELKAVRRANQKQPLIGLFAPGNMPVRWLGPTAT
YHGNLNQPAVSCEANPKRTADIPTLAQMTSKAIELLKDNPNGFFLQVEGASIDKQDHAAN
PCGQIGETVDLDEAVQKALAFAKADGETLVIVTADHAHSSQIIPPETAAPGLTQLLTTKD
GAPLAISYGNSEEGSQEHTGTQLRIAAYGPQAANVTGLTDQTDLFFTIRRALNLRD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaggttatcccctcgccctctctcttgccgtctccatggccgtgctcggcagc
gccttgccggcccaggcgcgccaggacgatccgtcgctgttcaaccgccaggcccgtggc
gaactcagcgagtacggcggcgcacggcgcgtcgagcaggacctgacccaggccctgaag
cagtcgctgtcgaagaagaaggcgaagaacgtgatcctgctgatcggcgacggcatgggc
gactccgagatcaccgtggcgcgcaactacgcgcgcggcgcgggcggctacttcaagggt
atcgatgcgctgccgctgaccggccagtacacccactactccctgcacaaggacagcggc
ctgccggactacgtgaccgattccgccgcctccgccaccgcctggaccaccggggtcaag
tcgtacaacggcgcgatcggcgtggatatccacgaacagccgcaccgcaacctgctggag
ctggccaagctcaacggcaaggccaccggcaacgtctccaccgccgagctgcaggacgcc
acccccgccgccctgctcgcccacgtcaccgctcgcaagtgctacggtcccgaggccacc
agcaagcagtgcccgagcaatgccctggagaacggcggcgccggctcgatcaccgagcag
tggctgaagacccgccctgacgtagttctcggcggcggcgccgcgaccttcgcggaaacc
gccaaggctggccgctatgccggcaagaccctccgcgcccaggccgaagcccgcggctac
cggatcgtcgagaacctcgacgagctgaaagccgtgcgccgcgccaaccagaagcagccg
ctgatcggcctgttcgcgccgggcaacatgccagtgcgctggctcggtccgaccgccacc
taccacggcaacctgaaccagccggcggtgagctgcgaggcgaacccgaagcgcaccgcc
gacatcccgaccctggcgcaaatgaccagcaaggccatcgagctgctgaaggacaatccg
aacggcttcttcctgcaggtcgagggcgcgtccatcgacaagcaggaccacgccgcgaat
ccgtgcggccagatcggcgagaccgtcgacctcgacgaagccgtgcagaaggccctggcc
ttcgccaaggccgatggcgagaccctggtgatcgtcaccgccgaccacgcccactccagc
cagatcatcccgccggaaaccgccgcgccggggctgacccaactgctcacgaccaaggac
ggcgcgccgctggcgatcagctacggcaactccgaggaaggctcccaggagcacaccggc
acccagttgcgcatcgccgcctacggcccgcaggccgccaatgtcaccggcctgaccgac
cagaccgacctgttcttcaccatccgtcgcgcactgaacctgcgcgactga

DBGET integrated database retrieval system