KEGG   Pseudomonas aeruginosa MTB-1: U769_27930Help
Entry
U769_27930        CDS       T02951                                 

Definition
(GenBank) membrane protein
Organism
paem  Pseudomonas aeruginosa MTB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2339
Motif
Other DBs
NCBI-ProteinID: AHB58806
LinkDB All DBs
Position
complement(6022844..6026449)
Genome map
AA seq 1201 aa AA seqDB search
MQWIFMLVGLILGGFAGESLVGALLGGLSGLALGQAVSLQNLAQQNERLRKQMSEFAERF
ERGTEVIHQRLLRVERQAQDLPESVSEPAADIDQPLADTPPAPPAEVAPPLDWDIELPAV
EAAPPPPRPPEPVQPIERQPAFQPDAQPAPRRAAPPAPPREPSLVERGFAAAKGWLFGGN
TVLRIGVVLLFIGLAFLLRYASERVAVPVEYRYAGVALAAMALLGVGWWLRERRAAYGLI
LQGTGIAVLYLTIFAAMRLHPLISPGAALALLVVVTICSAILAVLQNAMGLAVVAALGGF
AAPILTSTGSGNHVALFSYFALLNAGIFAIAWFRAWRPLNLVGFVGTFGIGFAWGLRSYT
PELFASTEPFLALFFLMYVGIGLLFARRKLLEAAQAPAERGELLRWSARQADYIDATVLF
GPPLVGFGLQCAVIGHIDFGMAFSALALGLFYMVLARALRGHASAGRTSLLVEICLALGV
VFGTLAIPLGLDARWTSAAWAVEGAGIYWLGLHQQRRLARLFALLLQGGAALAYLNGVRP
GETTLLEGSPLGALMLGAAALFSFWQLRRAPAKALADWEPACRPLLAAAGLAFLYLVAPL
CLAVDGTAIAWAVAGLASLFAGLRLGSRTFLFCAFAVQLLGGALFLLHLQGGDGQGGVFD
SGWRGLMTASLIGLALIGGMLLAARDPLVKDDSRLLMGLSLVLLAGLAFVNLAVLFVLPW
RSASAVWAGSGLLIIWLSLVLRQRLSFYFGLALQVVGGLAFLLAGPSLFGSLSGEGLRPL
AHSGFWTPAVLALAALVGAWRLRRAGERERALGIGTLGLAELSHLLLLWGAGWWALTALC
ETVRFVPYGLREHVLLLVAAATVASWMLLALRERWRELALLCLALVPVALLALASAWRFD
YQPFGEFGWLAWPLLFATHLLSLRRLAPLLPAKALSVAHVLGCWLLLGVLALELRYLFAL
LAEQYNAWRWLGWALVPSAYLLLVAGGRSLPWPLRDFPREYRLLAAAPVALLLLGWFWSA
NLLSDGAAEPLPYLPLANPLELGLLIVLFALYRWSDASLASLVDGNASARLGRQALAGAS
LFALLTLAVCRAAHHLAGVPFQADALAASMLVQAGLSLVWTLCALGLTIAGTRLGRRDLW
MVGAALVGVVVVKLFFVELGNSGSLERIISFIGVGVLLLVVGYFSPLPPRRAEVASEAEQ
P
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgcaatggattttcatgctggtgggcctgatcctcggcggcttcgccggggaatcgctg
gtcggcgccctcctcggcggcctttccggcctggccctgggacaggccgtctcgctgcag
aacctggcgcaacagaacgagcgcctgcgcaagcagatgagcgaattcgccgaacgcttc
gagcgcggcaccgaggtcatccaccagcgcctgctgcgcgtggagcgccaggcgcaggac
cttcccgaaagcgtttccgagccggccgccgacatcgaccagccgctcgcagacacgcct
cccgctcctcccgccgaggttgccccgccgctggactgggacatcgagctgccggccgtc
gaggctgcgccgcctccgcctcgtccccccgagcccgtccagcccatcgagcgtcagccg
gcgttccagcctgacgcccagccagcgccgcgccgtgccgcccctccagcgcctccacgc
gaaccctcgctggtcgagcgtggcttcgccgcggccaagggctggctgttcggcggcaac
acggtattgcgcatcggcgtggtgctgctgttcatcggcctggccttcctcctgcgctat
gcctcggaacgggtggcggtgccggtggagtaccgctacgccggggtggcgctggcagcg
atggcgctgctcggcgtcggctggtggttgcgcgagcggcgcgccgcctacggcctgatc
ctgcaaggcaccggtatcgcggtgctgtacctgaccatcttcgccgccatgcgcctgcat
ccgctgatctctcccggcgcggcgctggccctgctggtggtggtgacgatctgctcggcg
atcctcgccgtgctgcagaacgccatgggcctggcggtggtggcggcgctcggcggcttc
gccgcgccgatcctgacctccaccggcagcggcaaccatgtagcgctgttcagctacttc
gccctgctcaacgccggcatcttcgccatcgcctggttccgcgcctggcggccgctcaac
ctggtcggcttcgtcggcaccttcggcatcggtttcgcctggggactgcgctcctataca
ccggagctgttcgccagcaccgagccgttcctggccctgttcttcctgatgtacgtcggg
atcggcctgctcttcgcccgccgcaagctgctggaggccgcgcaggcgcctgccgagcgc
ggcgaactgctgcgctggtcggcgcgacaggccgactacatcgacgccaccgtgctgttc
ggcccgccactggtggggttcggcctgcaatgcgcggtgatcggccacatcgattttggc
atggccttcagcgccctggccctgggcctcttctacatggtcctggcgcgggcgctgcgt
ggccatgcttcggccggacgcaccagcctgctggtggaaatctgcctggcgctgggggtg
gtcttcggcaccctggccattccgctcggcctggacgcgcgctggacctcggccgcctgg
gccgtcgagggcgccggcatctactggctcggcctgcaccagcaacgccgcctggcgcgg
ctcttcgccctgctgttgcagggcggtgcggcgttggcctacctgaatggcgtgcggccg
ggtgagacgacgttgctggagggttcgccgctgggcgcgctgatgctcggtgcggcggcg
ctgttcagcttctggcagctgcgtcgcgcgccggcgaaagcgctggccgactgggagccg
gcctgccggccgttgctggcggccgccggcctggccttcctctacctggtcgcaccgctc
tgcctggccgtcgacggcaccgccatcgcctgggccgtggccggcctggcgagcttgttc
gccggcttgcgcctgggctcgcgtaccttcctgttctgcgccttcgccgtgcaactgctg
ggcggtgcgctgttcctcctgcatttgcagggcggcgatggccagggtggggtattcgac
tcgggctggcgtggcttgatgaccgcctcgctgattggcctggcgctgatcggcggcatg
ctgctggcggcgcgcgacccgctggtgaaggacgacagtcggctgctcatgggcttgagc
ctggtgctgctggccggtctggcgttcgtcaacctggcagtgctgttcgtcctgccttgg
cgcagcgccagcgcggtatgggccggtagcgggctgctgatcatctggctgagcctggtg
ctgcgccagcgcctgagcttctacttcggcctcgccttgcaggtagtgggcggcctggcg
ttcctcctcgccgggccgtcgctgttcggctcgctgagcggcgaaggcctgcggcccctg
gcccattccgggttctggacgccggcagtgctggccctggcggcgctggtcggcgcctgg
cggctgcgccgcgccggcgagcgcgagcgggcgctgggtatcggtaccctcggcctggcc
gagctgtcgcacctactgctgctctggggcgccggttggtgggcgctgaccgcgctgtgc
gaaaccgtccgtttcgtgccttatggcctgcgcgagcacgtgttgctgctggtggccgcg
gcgacagtggcgtcgtggatgctgctggcgctgcgcgagcgctggcgcgaactggccctg
ctgtgcctggcgctggtcccggtggcgctgttggccctggccagtgcctggcgtttcgat
taccagccgttcggcgaattcggctggctggcctggccgctgctgttcgccacgcacctg
ctgtcgctgcgacgccttgccccgttgctgccggcgaaggccctgagcgttgcccatgtg
ctcggttgctggctgttgctaggggtgctggcgctggagctgcgctacctgttcgccctg
ctcgccgaacagtacaacgcctggcgttggctgggctgggcgctggtcccgagcgcctac
ctgctgctggtggctggcgggcggagcctgccctggccgctgcgcgacttcccgcgggag
tatcggctgctcgccgctgcgccggtggcgctgttgctgctcggctggttctggagcgcc
aacctgctcagcgacggcgccgccgagccgctgccttacctgccgctggccaacccgctg
gaactggggctgctgatcgtgctgttcgccctctaccgctggagcgacgccagcctggcc
tcgctcgtcgatggcaatgccagcgcgcgcctggggcgccaggcgttggccggcgcctcg
ctgttcgccctgctgaccctggcggtgtgccgcgccgcgcaccacctggccggcgtgccg
ttccaggccgacgcgctggccgcgtcgatgctggtgcaggcggggctgtcgctggtctgg
acgctctgcgcgctgggcctgaccatcgccggtacccgtctcggccggcgcgacctgtgg
atggtcggcgcggcgctggtcggcgtcgtggtggtcaagctgttcttcgtcgagctgggc
aacagcggcagcctggagcgaatcatctccttcatcggggtcggcgtcctgttgctggtc
gtcggctacttctcacccttgcctccgcgtcgtgccgaggtcgcatcggaggccgagcag
ccatga

DBGET integrated database retrieval system