KEGG   Pasteurella aerogenes: NCTC13378_01377
Entry
NCTC13378_01377   CDS       T05989                                 

Gene name
metK
Definition
(GenBank) S-adenosylmethionine synthase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
paet  Pasteurella aerogenes
Pathway
paet00270  Cysteine and methionine metabolism
paet01100  Metabolic pathways
paet01110  Biosynthesis of secondary metabolites
paet01230  Biosynthesis of amino acids
paet01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:paet00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NCTC13378_01377 (metK)
Enzymes [BR:paet01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     NCTC13378_01377 (metK)
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N
Other DBs
NCBI-ProteinID: VEG71511
UniProt: A0A448K3G5
LinkDB
Position
1:complement(1467332..1468486)
AA seq 384 aa
MSSYLFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTS
AWVDIENLTRQVICEIGYEHSDMGFDGHSCAVLNAIGKQSSDINQGVDRENPLDQGAGDQ
GIMFGYATNETDVLMPAAITYAHRLMERQAQVRKSGKLAWLRPDAKSQVTLKYENNQIVG
VDAVVLSTQHSNEVSQKDVHEGVMEEIIKPVLPAQWLSKDTKYFINPTGRFVIGGPMGDC
GLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLS
YAIGVAEPTSIMVETFGTGKVANELLVKLVREFFDLRPYGLIKMLDLIQPIYRQTAAYGH
FGREQFPWEKIDRAEELRAAAGLK
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgtcatcttatctttttacttctgaatccgtgtctgaagggcatccggataaaattgcc
gatcaaatttccgatgcggtattagatgaaattttaaaacaagatccgaaagcgcgtgta
gcttgtgaaacctatgtaaaaaccggtatggcgttggtgggtggagagattacgacatcc
gcttgggtagatattgaaaacttaacacgtcaagtgatttgtgaaattggttatgagcat
tctgacatgggctttgacgggcattcttgcgcggtgttaaatgcgattgggaaacaatct
tctgatattaatcaaggggttgaccgcgaaaatccgttagatcaaggcgcgggcgaccaa
gggattatgtttggttatgccaccaatgaaacagatgtcttaatgccggcagcaattact
tatgcacaccgtttaatggagcgtcaggcacaggttcgtaaaagcggaaaattggcgtgg
ttacgtccggatgcaaaaagccaagtgacactaaaatatgaaaataatcaaattgttggt
gtggatgcggtggtactttctacacaacacagcaatgaagtcagccaaaaagatgtgcat
gagggcgtgatggaagaaattatcaaaccagtactaccagcccaatggttatccaaagat
accaaatactttatcaacccaacgggacgttttgtgattggtggtccaatgggcgactgc
ggtttgactggtcgtaaaattatcgtggatacctacggtggggcagcgcgtcatggtggc
ggtgctttttctggtaaagatccgtccaaagtggatcgttcagctgcttacgctgctcgc
tatgtggcgaaaaatatcgttgccgccggtttggcggatcgttgcgagatccaactttct
tacgccattggtgttgctgaaccgacatcaattatggtggaaacctttggtacgggcaaa
gtggcgaatgaattattggtcaaattggtgcgtgaattctttgatttacgcccatacggt
ttaattaaaatgttagatttaattcaaccgatttaccgccaaaccgctgcttacggacac
tttggtcgcgaacaattcccatgggaaaaaattgatcgcgccgaagaattacgtgccgcc
gcgggcttaaagtaa

DBGET integrated database retrieval system