KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_84
Entry
N297_84           CDS       T03097                                 

Definition
(GenBank) type VI secretion system OmpA/MotB family protein
  KO
K11892  type VI secretion system protein ImpK
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
Pathway
paev03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paev00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    N297_84
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paev02044]
    N297_84
Secretion system [BR:paev02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   N297_84
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: AGY70473
LinkDB
Structure
PDB: 
4B62

Position
complement(95048..96397)
AA seq 449 aa
MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGDPYTPPPMASLAPLSG
RGDGLNPLEQAAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQFEEKARQAGVAPDEVM
LARYVLCTALDEAVLSTPWGSTSDWGKQSLLITLHNEAWGGEKVFQLLEHCLQNPHQRLH
LLELLYLCTSLGFEGRYRVMHDGRSQLEALRERTAAVIRSTRGEYEHELSPHWRGLSVMR
DRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFKRIHAIGEIPVQAIDRPAVQP
RVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDEFQPLLLRIAD
ALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSD
TEPVATNASAEGRARNRRVEITVFAEGAQ
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgcctcccatcgacgatcccttcggcaccccggccggcggcggcaacggaagcccgccc
gacgaccgcaccatgatcatgccgcgtcccggcggccgcgccccggaaccggccggcggc
ccccgcggcggcgatccctacacgccgccgccgatggccagcctggcgccgctgagcggc
cgcggcgacggcctcaacccgctggagcaggccgccggcccactgctggcgatgctcacc
cgcctgcgcaacaccatcgcccatccggcgccggccagcctgcgcgcgcaactgctcggc
tacctgcgccagttcgaggagaaggcacgccaggccggcgtggcgccggacgaagtgatg
ctggcgcgctacgtgctctgcaccgccctcgacgaagcggtgctcagcacgccgtggggc
agcaccagcgactggggcaagcagagcctgctgatcaccctgcacaacgaggcctggggc
ggcgagaaggtcttccagttgctcgaacactgcctgcagaacccgcaccagcgcctgcac
ctgctggagctgctgtacctgtgcaccagcctcggcttcgaaggccgctaccgggtcatg
cacgacggccgcagccaactggaggcgctgcgcgagcgcaccgcggcggtgatccgcagc
acccgcggcgagtacgagcacgaactgtcgccgcactggcgcggcctcagcgtgatgcgc
gaccgcctttcgcaatacctgccgccgtgggtcggtatcgccatcggcctggccttgctg
ctggccttgctgttcggcctgcggatgaagctggccgccgacgccgagccggtgttcaag
cgcatccacgccatcggcgagatcccggtgcaggccatcgaccgcccggcggtgcagccg
cgggtgatcgagcggccacgcctggcgcgcttcctcgccgacgacatcaaggcccagcga
gtggcggtggaggacgccgtcgaccgctcggtggtgaccatccgcggcgacgagctgttc
gccagcgccagcgccagcgtgcgcgacgagttccagccgctgctgctgcgcatcgccgac
gccctgcgcaaggtcaagggccaggtgctggtcaccggccatagcgacaaccggccgatc
gccacgctgcgctacccgtccaactggaaactgtcccaggcccgcgcccaggaggtcgcc
gacctgctcggcgcgaccaccggcgacgccggccgcttcaccgccgaagggcgcagcgac
accgagccggtggcgaccaatgccagcgccgaaggccgcgcacgcaaccgccgggtggaa
atcaccgtattcgcggagggcgcgcaatga

DBGET integrated database retrieval system