KEGG   Pantoea agglomerans C410P1: BEE12_00665Help
Entry
BEE12_00665       CDS       T04739                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pagc  Pantoea agglomerans C410P1
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BEE12_00665
Enzymes [BR:pagc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BEE12_00665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 NAD_binding_8 Thi4 Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AOE38527
UniProt: A0A379AEG1
LinkDB All DBs
Position
complement(160524..162092)
Genome map
AA seq 522 aa AA seqDB search
MLDTNLKTQLKAYLEKLTKPVELIATLDEGAKSTEIRELLVDIAGLSDKVSFREENDRQV
RKPSFLITNPGSNSGPRFAGSPLGHEFTSLVLALLQTGGHPSKEAQSLLDQIAALDSDFH
FETYYSLSCHNCPDVVQALNLMAVINPRISHTAIDGGLFQNEIQERNVMGVPAVYLNGKE
FGQGRMSLAEIVSKVDTNADKRAAEELNKRDAYEVLIIGSGPAGAAAAIYSARKGIRTGL
LGERFGGQVLDTVDIENYISVPKTEGAKLAGSLRAHVDDYNVDVIESQSAIKLIPAAKEG
GMHAIETASGAVLKSRSIILATGARWRNMGVPGEEEYRTKGVTYCPHCDGPLFKGKRTAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAGEMRADQVLQDKLRSLKNVDVILNAQTTEVKGD
GTKVTGLHYIDRTTQTTHELPLSGIFVQIGLLPNTPWLEGAVERNKMGEIIIDGKCETSL
KGVFAAGDCTTVPYKQIIIASGEGAKASLSAFDYLIRTKSAE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatctgaaaacccagctcaaggcttaccttgagaaattaaccaaacct
gttgagttgattgccacgctggacgaaggtgcaaaatcaaccgagatccgtgaactgttg
gttgatatcgccggtttgtctgacaaagtcagcttccgcgaagagaacgatcgtcaggtg
cgtaagccctcatttctgatcaccaacccaggttcgaacagcggcccgcgttttgccggt
tcacctctgggtcacgaatttacctcactggtgctggcactgttacagaccggtgggcat
ccgtcgaaagaagcacaaagcctgctggatcagattgccgcgctggacagcgatttccat
ttcgaaacctactattcactctcatgccataactgccctgacgtcgtacaggcgctgaac
ctgatggcggtgattaacccgcgtatcagccacaccgctatcgacggtggcctgttccag
aacgagattcaggaacgtaacgtgatgggcgtgccagcggtttacctcaatggtaaagag
tttggtcagggtcgcatgagcctggcggaaatcgtcagcaaagtggataccaatgcagac
aaacgtgcggcggaagagctgaacaagcgtgacgcctatgaagtcctgattatcggcagc
ggcccggcgggcgcagcggcagccatctactcagcacgtaaaggtatccgtaccggcctg
ctgggtgagcgttttggcggccaggtgctggatacggtcgatatcgaaaactatatctcc
gtaccgaaaaccgaaggggcaaaactggccggttcactgcgcgcacacgtagacgattac
aacgtggacgtcattgaaagccagagcgccatcaaactgatcccggcagcgaaagagggc
ggaatgcacgccatcgaaaccgcctctggcgcagtattgaaatcacgcagcatcatcctg
gcgaccggcgcacgctggcgtaacatgggcgtgccgggtgaagaagagtatcgcaccaaa
ggcgtgacctactgcccacactgcgatggcccgctgtttaaaggcaaacgcacggcggtg
atcggcggcggtaactccggcgtggaagcggccattgacctggccggtatcgttgaacac
gttacgctgctggagtttgccggtgagatgcgcgccgatcaggtgctgcaggataagctg
cgcagcctgaagaacgtggatgtgattctgaacgcccagaccaccgaagtgaaaggcgac
ggcaccaaagtcaccggcctgcactatatcgatcgcacgacgcagaccactcatgagctg
ccgctctccggtatcttcgttcagatcggtctgttgccaaataccccatggctggaaggg
gcggttgagcgcaacaaaatgggtgaaatcatcatcgatggtaaatgcgaaaccagcctg
aaaggcgtgttcgccgcgggcgactgcaccaccgtaccgtacaagcagatcatcatcgcc
agcggcgaaggtgctaaagcctcactgagcgcttttgactatctgattcgtaccaaatcg
gctgagtaa

DBGET integrated database retrieval system