KEGG   Pantoea agglomerans C410P1: BEE12_01305Help
Entry
BEE12_01305       CDS       T04739                                 

Definition
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc00061  Fatty acid biosynthesis
pagc00780  Biotin metabolism
pagc01100  Metabolic pathways
pagc01212  Fatty acid metabolism
Module
pagc_M00083  Fatty acid biosynthesis, elongation
pagc_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BEE12_01305
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BEE12_01305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pagc01004]
    BEE12_01305
Enzymes [BR:pagc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     BEE12_01305
Lipid biosynthesis proteins [BR:pagc01004]
 Fatty acid synthase
  Component type
   BEE12_01305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc Cerato-platanin
Motif
Other DBs
NCBI-ProteinID: AOE38640
UniProt: A0A379ACU3
LinkDB All DBs
Position
complement(329339..330559)
Genome map
AA seq 406 aa AA seqDB search
MKRAVITGLGIVSSIGNNQQEVLSSLREGRSGITFSEEMKDSGMRSHVWGNVKLDTTGLI
DRKVVRFMSDASIYAYLSMEEAIKDSGLSAEAYQSNPRVGLIAGSGGGSPRFQVFGADAM
RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG
KQDIVFAGGGEELCWEMACEFDAMGALSTRYNDTPEKASRTYDNERDGFVIAGGGGMVVV
EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT
STPVGDVKELGAIREVFGDNTPYISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
ITSLDAAATGMNIVTEPMEKELTTVMSNSFGFGGTNATLTMRKYQA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgctgtgattactggcttagggatcgtttccagtattggtaataaccagcag
gaggtgctgtcatctctgcgtgaaggacgctctggcatcaccttttctgaagagatgaaa
gattccggcatgcgtagtcacgtctggggtaacgttaaattagataccaccggcctcatc
gatcgcaaagttgtgcgctttatgagtgatgcgtccatctatgcttatctttccatggaa
gaagcgattaaagattctggcctcagcgctgaagcgtatcagagcaacccacgtgtgggt
ctgattgcgggttcaggcggcggctccccgcgtttccaggtatttggtgctgatgcaatg
cgcagcccacgcggcctgaaagcggttggcccttatgtggtcaccaaagcgatggcctct
ggcgtctctgcctgcctcgcaacgccattcaaaattcatggcgtaaattactcgattagc
tccgcctgtgccacctctgcgcactgtatcggtaacgccgttgagcagatccagcttggc
aaacaggatatcgtttttgcgggcggcggcgaagagctgtgctgggaaatggcctgtgag
ttcgacgccatgggcgcgctctctacccgttacaacgacacgcctgaaaaagcgtcacgc
acttatgacaatgagcgcgacggctttgttatcgccggtggcggtggcatggtcgtcgtt
gaagagctggagcatgcgctggcacgtggtgcgcatatctatgccgaaatcgtcggttat
ggtgccacttcagacggtgcagacatggttgctccatcaggtgaaggcgcagtgcgctgc
atgaagatggcgatgcacggtgtcgataccccaattgactatctgaacagtcacggaacc
tctaccccggtgggtgatgtgaaagagctgggtgcgattcgtgaagtgtttggcgataac
acgccatacatctcagcaacgaaagcgatgaccggccactctctgggtgcggctggcgtg
caggaagcgatctactcgctgctgatgctggagcatggctttatcgcgccaagtatcaac
atcacctcgcttgacgcggcagcaaccggtatgaacatcgtcactgagccgatggaaaaa
gagctgactaccgtgatgtctaacagctttggttttggcggcaccaacgccacgctgacc
atgcgtaaatatcaggcgtaa

DBGET integrated database retrieval system