KEGG   Planktothrix agardhii: NIES204_03800
Entry
NIES204_03800     CDS       T05658                                 

Definition
(GenBank) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh00230  Purine metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_03800
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NIES204_03800
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     NIES204_03800
SSDB
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Other DBs
NCBI-ProteinID: BBD53117
UniProt: A0A2Z6C9H9
LinkDB
Position
458346..459338
AA seq 330 aa
MIRSAILPLPYSEPLVADHGRLRLFSGSANIPLSLEVSRYLGIDLGPMVRKRFADGEIYI
QIQESIRGCDVYLIQPCCYPVNDNLMELLIMIDACKRASARQITAVIPYYGYARADRKTA
GRESITAKLVANLITEAGASRILAMDLHSAQIQGYFDIPVDHVYGSPVILDYLISKQLPD
LVVVSPDVGGVARARAFAKKLNDAPLAIIDKRRQAHNVAEVLNVIGDVKGKTAVLVDDMI
DTAGTICEGARLLRREGARQVYACATHAVFSPPAIERLSSGLLEEVIVTNTIPIIPEKQF
EQLKVLSVANLVGETIWRIHEDSSVSSMFR
NT seq 993 nt   +upstreamnt  +downstreamnt
gtgatccgttctgctatattgccccttccttattctgagccattggttgctgatcatggt
cggttacgactattttcggggtcggcaaatattcctctttccctagaggtaagccgttat
ttaggaattgacttagggccaatggttcgtaagcgattcgctgatggagaaatttacatc
cagattcaagagtccattcgaggctgtgatgtttatttgattcaaccctgctgttatccg
gtcaatgacaacctaatggagttattgatcatgattgacgcctgtaaacgggcttctgcc
cgtcaaattacagccgttatcccttattacggatatgctagagccgatcgcaaaaccgca
ggtcgtgagtcaatcaccgcaaaattagtggccaacttgattactgaagcgggtgctagt
cggattctggccatggatttacactcagcccagattcaagggtatttcgacattccggtt
gatcatgtctatggttctccggtaattttggattacctgatcagcaaacagttacccgat
ctggtggttgtttcccctgatgtcggtggagtcgccagggctagagcttttgctaaaaaa
ctcaatgacgcacccctagcgattattgataaacgccgtcaagcccataatgtcgccgaa
gttctgaatgtaattggtgatgttaagggtaaaaccgccgttttagtcgatgacatgatt
gacacggctggaacgatttgtgaaggcgctcgtttactccgtcgagaaggagcgcgtcaa
gtctacgcctgcgccacccatgcggtcttttctccccctgccatcgaacgtctatcgagt
gggttacttgaggaagtcattgtgactaatacaattccgatcatacctgagaaacagttt
gaacagttaaaggttttatctgttgctaatttggtcggtgaaacgatttggcggatacat
gaagatagctctgtgagcagtatgttccgttaa

DBGET integrated database retrieval system