KEGG   Planktothrix agardhii: NIES204_06780
Entry
NIES204_06780     CDS       T05658                                 

Definition
(GenBank) putative succinate dehydrogenase flavoprotein
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00020  Citrate cycle (TCA cycle)
pagh00190  Oxidative phosphorylation
pagh00650  Butanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIES204_06780
   00650 Butanoate metabolism
    NIES204_06780
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NIES204_06780
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NIES204_06780
    1.3.5.4  fumarate reductase (quinol)
     NIES204_06780
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 GIDA Pyr_redox_2 Lycopene_cycl FAD_oxidored
Other DBs
NCBI-ProteinID: BBD53405
UniProt: A0A2Z6CAG5
LinkDB
Position
822922..824649
AA seq 575 aa
MLEHDVIIVGGGLAGCRAAVEMARTNPSLNIAIVAKTHPIRSHSVAAQGGIAATLKNIDE
SDSWQAHAFDTVKGSDYLADQDAVEILAKEAPDVIIDLEHLGVLFSRLPDGRIAQRAFGG
HSHNRTCYAADKTGHGILHELVSNLRRYGVHIYDEWYVLRLILEDGQAKGVVMFRIDDGQ
LTVVRAKAVMFATGGYGRAFNTTSNDYASTGDGLAMAAMAGVPLQDMEFVQFHPTGLYPV
GVLISEAVRGEGAYLINSNGERFMATYAPSRMELAPRDITSRAITLELRAGRGINPDGSA
GGPYIYLDLRHLGREKIMSRIPFCWEEAHRLLGIDAVVEPMPVRPTVHYSMGGIPTNING
QVLSGADSFVDGLFSAGEAACISVHGANRLGSNSLLECVVYGKRTGAAIAQFVQNRKLPN
IDEQRYLKETALQLQGLLDQSGDYRIGKLRQEFQDAMTSHCGVFRTDTVMREGLSQIQEL
QNRYQRIYLDDKGKCWNTELIEALELKSLMIVGNMILTSALSRQESRGAHSREDYPQRHD
ETFLKHTLAYYSPAGIDLAYRPVKITLFEPQERKY
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgctagaacatgatgtgattattgttgggggcgggttggcaggatgtcgggcggccgta
gaaatggcccggactaaccccagcctgaatatagctattgttgccaaaactcaccccatc
cgttcccattccgtcgctgcccaagggggtattgctgccaccttaaaaaatattgatgaa
agtgatagttggcaagcccacgcctttgataccgtcaagggttcagactatttagctgac
caagatgctgtcgaaattttagccaaagaagccccggatgtaattattgatttagaacat
ttgggcgtattattttcccgtcttcccgatggccggattgctcaacgggcttttgggggc
cattcccataatcgcacttgttacgctgctgataaaacaggtcatgggattttacacgaa
ctggtcagtaacctgcgacgctatggtgtccatatctatgatgaatggtatgtgctgcgt
ctgattttagaagacggacaggccaaaggggtggtcatgttccgaattgatgatggacag
ttaaccgttgtccgggctaaggcggtgatgttcgccaccgggggctatggtcgggcattt
aataccacttccaatgactatgcctcaaccggggacgggctggcgatggcggcaatggcg
ggggttcccttgcaagatatggaatttgtccagttccatcctacgggactatatccggtg
ggggtgttaatttccgaggctgtgcggggggaaggagcctatttaattaatagtaatggg
gagcggttcatggcgacttatgccccgagtcggatggaattagcacctagggatattact
tctcgcgcgattactttagaactgcgggcaggccgtggaattaaccccgatggcagtgcc
ggggggccctatatttatttggatttgcgacatttaggacgggaaaaaattatgagtcgg
attcccttttgttgggaagaagctcaccgtttattaggaattgatgcggtggtggaaccg
atgcctgtacgtcccacggttcactattctatgggaggtattcccactaatattaatggt
caagttttaagtggtgcggatagttttgttgatggattattttccgccggagaagccgct
tgtatatcggtgcatggagctaatcgtttaggcagtaattctttattagaatgtgtggtt
tatggaaaaagaaccggggcggctattgcccaatttgtgcaaaatcgcaagttaccaaat
attgatgaacagcgttatttgaaagaaactgcattgcaattacaaggtttattagaccag
tctggagactacagaattggaaaactgcgtcaggagtttcaagatgctatgacctcccat
tgtggtgtatttagaaccgatacagttatgcgagaagggttaagtcaaattcaggagtta
cagaatcgttatcaacggatttatttagatgataaaggcaaatgttggaatacagaatta
attgaagcattggaattaaaaagtctgatgattgtaggaaatatgattttaacttcggcc
ttaagtcgccaagaaagtcgaggcgcccatagtcgggaagattatcctcaacgccatgat
gaaaccttcctaaaacatactttagcctattattcccctgcgggtattgatttagcctat
cgtccggtaaaaattaccctatttgaaccccaggaacgtaaatattaa

DBGET integrated database retrieval system