KEGG   Planktothrix agardhii: NIES204_20220
Entry
NIES204_20220     CDS       T05658                                 

Definition
(GenBank) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00030  Pentose phosphate pathway
pagh00052  Galactose metabolism
pagh00230  Purine metabolism
pagh00500  Starch and sucrose metabolism
pagh00520  Amino sugar and nucleotide sugar metabolism
pagh00521  Streptomycin biosynthesis
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_20220
   00030 Pentose phosphate pathway
    NIES204_20220
   00052 Galactose metabolism
    NIES204_20220
   00500 Starch and sucrose metabolism
    NIES204_20220
   00520 Amino sugar and nucleotide sugar metabolism
    NIES204_20220
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NIES204_20220
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NIES204_20220
Enzymes [BR:pagh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NIES204_20220
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Other DBs
NCBI-ProteinID: BBD54726
UniProt: A0A2Z6CE81
LinkDB
Position
complement(2342441..2344075)
AA seq 544 aa
MNIRTVSTQPFNDQKPGTSGLRKSVPAFQKPHYLENFVQAIFDTQEGYEGGTLILGGDGR
YYNRQAIQIILKMAAANGVGKVLVGSGGIVSTPAASCIIRENRAFGGIILSASHNPGGPE
GDFGIKFNGSNGGPAVEKITEAIYARTLVIDRYNIMEAADINLDQPGSFKLGTMDVEVLD
SVQPYRSLMESLFDFDLIQKLLTSGKFRMCVDSMHAVTGPYACAIFENRLGATPGTVVNG
IPLEDFGGGHPDPNLVYAHDLVEIMFGENAPDFGAASDGDGDRNMILGNNFFVTPSDSLA
IITANAHLVPGYKGGLAGVARSMPTSQAPDRVAAKLGINCYETPTGWKFFGNLLDAGKAT
LCGEESFGTGSNHVREKDGLWAVLFWLNILAVRQESVEDIVRSHWQTYGRNYYSRHDYEE
VETEKANQLVDQLQAILPNLKGKQYGSYQVEYSDNFSYTDPVDNSISNNQGIRIGFTDGS
RIVFRLSGTGTKGATLRVYLESYEPDPTKHNLDPQEALGELITIADEIAQIKTITGRQQP
TVIT
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgaatattcgtaccgtttcaactcaaccctttaacgaccaaaaaccgggaacatccggc
ctacgcaagtccgttcctgcctttcaaaaaccccattacctagaaaatttcgttcaggcg
atttttgatacccaagaggggtatgaaggcggaaccctaattttaggtggagatggtcgc
tactataaccgccaagccattcaaattatcttaaaaatggccgctgctaacggcgttgga
aaggttctcgtcggatctgggggcattgtttccactccagccgcatcttgtataatccgc
gaaaatcgagcctttggggggattattctctctgcaagccataaccccggagggccagaa
ggagattttgggatcaagttcaacggcagtaatggtgggccagccgtcgaaaaaatcacc
gaagcgatttatgcccgtaccctggtgattgaccgctacaacatcatggaggcggctgat
attaatttagatcaacccggaagttttaaactgggaaccatggacgttgaggtgctcgat
tccgtccaaccctacaggtcattgatggaatccttatttgattttgacctaattcaaaaa
ttattaacttcgggtaagtttcggatgtgtgtggactccatgcacgcggtaactggcccc
tatgcctgcgccatttttgaaaaccgcttaggggccacacccggaaccgtggtcaatggt
attcccttagaggattttggtggcggtcatcccgatcctaatttagtttatgcccatgat
ttagtcgaaattatgttcggggaaaatgccccggattttggggcggcgtccgatggagat
ggcgatcgcaatatgattttaggaaataatttttttgtcacccccagtgatagtttagcc
atcatcaccgccaatgcccatttagttcccggatataaaggcggtttagccggggtagcc
cgttccatgcccacttcccaagcgcctgatcgtgtggcggcaaaattaggcataaactgt
tatgaaacccctaccggatggaagtttttcggcaatttattagatgcaggaaaagctaca
ttatgcggggaagaaagttttggaaccggatcaaatcatgttcgggaaaaagatggatta
tgggcggtattattctggttaaatattttagccgtccgtcaagaatccgtggaagatatt
gttcgcagtcattggcaaacctacggacgcaattattattctcgccatgattatgaagaa
gtagaaacagaaaaagccaatcaattagttgatcaattacaggcaattttaccaaatcta
aaaggtaaacaatacggttcctatcaagtcgaatatagtgataattttagctataccgat
ccggtggataatagtattagtaataatcaggggattcggattgggtttaccgatggttct
cggattgtctttcggttatcagggacgggaactaaaggggcaaccttacgggtttattta
gaaagttatgaacccgaccccactaaacacaatttagatccccaagaggcgctaggagaa
ttaattactattgccgatgaaattgcccaaatcaaaaccataaccggacgtcaacaaccc
actgttattacttaa

DBGET integrated database retrieval system