KEGG   Planktothrix agardhii: NIES204_24830
Entry
NIES204_24830     CDS       T05658                                 

Gene name
pgk
Definition
(GenBank) phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pagh_M00002  Glycolysis, core module involving three-carbon compounds
pagh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pagh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pagh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_24830 (pgk)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_24830 (pgk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pagh04147]
    NIES204_24830 (pgk)
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     NIES204_24830 (pgk)
Exosome [BR:pagh04147]
 Exosomal proteins
  Proteins found in most exosomes
   NIES204_24830 (pgk)
SSDB
Motif
Pfam: PGK TcpA
Other DBs
NCBI-ProteinID: BBD55181
UniProt: A0A2Z6CF21
LinkDB
Position
2808427..2809623
AA seq 398 aa
MSKKTVADLSASDLSGKRVLVRVDFNVPLDNGSITDDTRIRAALPTIQDLTSKGAKVILT
SHFGRPKGVDESLRLTPVAARLSELLGKPVKKFDDCIGDEVTQAVAAMENGDVAVLENVR
FYAEEEKNDPEFAKQLASVADLYVNDAFGTAHRAHASTEGVTHHLPSVAGYLIEKELKFL
QGAIEEPKRPLAAIVGGSKVSSKIGVIEALLDKCDKLLLGGGMIFTFYKARGLNVGNSLV
EEDKLELARALEAKAKQKGVAFLLPTDVIVADKFAPDAEAKTVSINEIPDGWMGLDIGPD
SVKVFQDALGDCKTVIWNGPMGVFEFEKFAAGTKAIALTLADLTKTGAITIIGGGDSVAA
VEQLNLGEQMSHISTGGGASLELLEGKVLPGIAALDDA
NT seq 1197 nt   +upstreamnt  +downstreamnt
gtgtcaaaaaaaactgtagcagatttatccgcatcagatttatctgggaaacgggtatta
gtccgcgttgattttaatgttcccctagataacggttcaattaccgatgatacacggatt
cgtgcggctctgccgactatccaagatttaacttccaaaggcgctaaagtgattttaacc
agccactttggccgtcctaaaggcgtagacgagtccctgcgtttaacccctgtggcagcc
cggttatcggaattgttaggtaaacctgttaagaaatttgacgattgtattggggatgaa
gtcacccaagcggttgcagccatggaaaatggggatgtcgccgtattagaaaacgtccgt
ttctatgccgaagaagaaaaaaacgatccggaatttgctaaacaattagcttctgttgct
gatttatacgttaatgatgcttttggaaccgcccaccgcgcccatgcttctactgaagga
gtaactcatcatttgccttctgtcgcggggtatttaattgaaaaagaactcaagttttta
caaggagcaattgaagaacccaaacggcctttagctgctattgttggcggttctaaagtg
tcttctaaaattggtgtaattgaagctcttttagataaatgcgataaattgctgttgggc
ggtgggatgattttcaccttctataaagctcgcggtttgaatgtgggtaattctttggtg
gaagaagataaactggaattagcccgggcattggaagccaaagctaaacaaaaaggcgtg
gcattcttattacctaccgatgtgattgttgctgataaatttgcccctgatgcggaagca
aaaaccgttagcattaatgagattcctgatggttggatggggttagatattggcccggat
tctgttaaagtcttccaagacgctttaggggattgcaaaaccgtgatttggaacggcccc
atgggggtttttgagtttgagaaatttgcagccggaactaaagcaatcgctttaacgtta
gcagatttaaccaaaacaggcgcaattactattatcggtggcggtgactccgttgcggcg
gtggaacagttgaatttaggcgaacaaatgagccatatttctactggaggtggcgccagt
ttagaactgttagaagggaaagtattacctggaattgctgcgttagatgatgcgtaa

DBGET integrated database retrieval system