KEGG   Planktothrix agardhii: NIES204_33320
Entry
NIES204_33320     CDS       T05658                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh00480  Glutathione metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pagh_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_33320 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NIES204_33320 (gnd)
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     NIES204_33320 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     NIES204_33320 (gnd)
SSDB
Motif
Pfam: 6PGD NAD_binding_2 ApbA 2-Hacid_dh_C Shikimate_DH PGK NAD_binding_11 3HCDH_N
Other DBs
NCBI-ProteinID: BBD56012
UniProt: A0A2Z6CI74
LinkDB
Position
3735297..3736718
AA seq 473 aa
MTLQKFGVIGLAVMGENLALNVERNGFPIAVYNRTGAKTDEFMEQRAQGKNVKAAYTLEE
FVQSLERPRRILVMVKAGKPVDAVIDQLKPLLDQDDMIIDGGNSLYEDTERRTKELEATG
LGFVGMGVSGGEEGALWGPSLMPGGTEASYKELEPILVKIAAQVDDGPCVTFIGPGGAGH
YVKMVHNGIEYGDMQLIAEAYDLLKNVAGLSAAQLHEVFAQWNTTDELNSFLIEITADIF
KKIDPETGFPLVDLIVDAAGQKGTGRWTVMSALELGVSIPTIIAAVNSRIISSYKDQRVA
ASVELPWPTSEYQGNISELVNKIRDALYCSKICSYAQGMALLGAASKEYGYNLDLGEMAR
IWKGGCIIRAGFLNKIKAAFSENPDLPNLLLAPEFKQTILDRQQAWREVLVIANQFGIPV
PAFSASLDYFDSYRRATLPLNLTQAQRDYFGAHTYQRTDKPRGEFFHTEWTKD
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaccctgcaaaaatttggtgtaattggtctagccgtcatgggtgaaaacctggccctc
aacgttgagcgtaatgggtttccgatcgcagtgtataaccgcaccggggctaaaaccgat
gagttcatggagcaacgggcccagggaaaaaacgtcaaagcagcctataccctagaagaa
tttgtccaatccctagaacgtccccgccgtattctagtcatggtgaaagcagggaaaccc
gttgatgcggttattgatcagcttaaacctttgctagatcaagatgacatgattattgat
ggtggaaactccctctatgaagataccgaacgtcgcaccaaggaattagaagccacgggt
ttagggtttgtgggcatgggtgtgagtgggggggaagaaggcgctctctggggccccagc
ctgatgccagggggtacggaagcctcctataaagaattagagccgattttagtcaaaatt
gccgcccaagttgatgacggcccctgtgtgacttttattgggccagggggagcgggtcac
tacgttaaaatggtgcataacgggattgaatatggcgatatgcagttaattgcagaagcc
tatgacctgctgaaaaatgtcgccgggttgagtgcggcccaactccatgaagtttttgcc
caatggaataccaccgacgaactcaattcttttctgattgaaattacggcggatattttc
aaaaaaattgaccccgaaactggttttcctttagttgatttaattgttgatgcagccgga
caaaaaggcaccggacgttggacagttatgagtgctttggagttaggagtttcgattcca
acaattatcgcggcggtgaatagtcggattatttcttcctataaggatcaacgggtagcc
gcttccgtagaattgccttggccgacgagtgaatatcagggaaatatttctgagttagtg
aataaaattcgggatgcgttgtactgttctaaaatttgttcctatgctcaagggatggct
ttattgggtgccgcttctaaggagtatgggtataatttggatctcggagaaatggcacga
atttggaagggaggctgtattattcgggcgggatttttgaataaaattaaagccgctttt
agtgagaatcctgacttaccgaatttgttattagcaccggaattcaaacagacgatttta
gatcgtcaacaagcctggcgggaagtgttagtaattgctaatcaatttggcattccagtt
ccggcttttagtgcgtccttagactattttgatagttaccgacgggcaactttacccttg
aatttaacccaagcccaacgggattattttggtgcccatacgtatcaacgcaccgataaa
cccaggggtgagtttttccacacggaatggacaaaagactaa

DBGET integrated database retrieval system