KEGG   Planktothrix agardhii: NIES204_40740
Entry
NIES204_40740     CDS       T05658                                 

Gene name
lpdA
Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00020  Citrate cycle (TCA cycle)
pagh00260  Glycine, serine and threonine metabolism
pagh00280  Valine, leucine and isoleucine degradation
pagh00310  Lysine degradation
pagh00380  Tryptophan metabolism
pagh00620  Pyruvate metabolism
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh00640  Propanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_40740 (lpdA)
   00020 Citrate cycle (TCA cycle)
    NIES204_40740 (lpdA)
   00620 Pyruvate metabolism
    NIES204_40740 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_40740 (lpdA)
   00640 Propanoate metabolism
    NIES204_40740 (lpdA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIES204_40740 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    NIES204_40740 (lpdA)
   00310 Lysine degradation
    NIES204_40740 (lpdA)
   00380 Tryptophan metabolism
    NIES204_40740 (lpdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pagh04147]
    NIES204_40740 (lpdA)
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     NIES204_40740 (lpdA)
Exosome [BR:pagh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NIES204_40740 (lpdA)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_oxidored FAD_binding_2 GIDA K_oxygenase 3HCDH_N UDPG_MGDP_dh_N AlaDh_PNT_C 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: BBD56740
UniProt: A0A2Z6CK98
LinkDB
Position
complement(4500989..4502419)
AA seq 476 aa
MDYDLVIIGAGVGGHGAAIHAVGCGLKTAIIEAADMGGTCVNRGCIPSKALLAASGRVRE
LHNTHHLKNLGIQLGQVSFDREQIANHADNIVTKLRGDLTNSLKRLGVDVIQGWGKIAGA
NKVTVETTNGEKTITAKDIILAPGSVPFVPPGITIDHQTVFTSDDAVKLASLPQWIAIIG
SGYIGLEFSDIYTALGCEVTMIEALDQLMPTFDPDIAKLAQRVLINPRDIETKVGKLALK
VTPGSPVIIELADTKTKEVEEVLEVDACLVATGRIPVSKNLGLESVNVEPIRGGFIPTND
HLEVLSGGEPVPHLWAIGDATGKMMLAHTASAQGVAVVETICGRPRAVDYRSIPAAAFTH
PEISYVGLTEPAAKELGQTEGFEIATVKTYFKGNSKAIAEGETEGMAKVIYRKDTGEILG
VHIFGLHASDLIQEAANAMYHRQSVHDLVFSVHTHPTLSEVLDEAYKRAVFSVGGH
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggattacgatttagtgattattggtgcgggagtgggcggacatggtgctgctatccac
gccgtcggttgtggcttgaaaaccgcaattattgaggcggcggacatggggggaacttgt
gttaaccgaggctgtattccctctaaagcgttattagcggcgtcgggacgggtcagagaa
ttacataatacccatcacttaaaaaatttagggattcagttaggacaagtcagttttgat
cgtgaacaaattgctaaccatgctgataatattgtcactaaacttcggggtgacttgact
aatagtttgaagcggttaggggttgatgtaattcaaggttggggtaaaattgccggggcg
aataaagttaccgttgaaactactaacggagaaaaaacaattaccgctaaagatattatt
ttagcaccgggttctgtgccttttgttcccccaggaattacgattgatcatcaaacagtt
tttaccagtgatgatgcggttaaattagcatccctaccccaatggattgcgattattgga
agtggctatatcggattagaattttctgatatttatacggctttaggttgtgaagttacc
atgattgaagccttagatcaattaatgccaacttttgatcctgatattgctaaattagct
caacgggttttaattaatcccagggatattgaaactaaagtcggaaaattagccttaaaa
gtaacgcctggttctccggttattattgagttagccgataccaaaactaaagaagtagaa
gaagtactagaagtggatgcttgtttggttgctaccgggcggattccggtgagtaaaaat
ttaggtttagaatcggtgaatgttgaacctattcggggcggttttattcctacaaatgat
catttagaggtattgtctggaggcgaacctgttccccatttatgggcgattggagatgcg
acgggtaaaatgatgttagcccataccgcatccgcccagggagtagccgttgtagagact
atttgcggacgtcctcgcgccgtagattatcgtagtattccggcggctgcttttacccat
cctgaaattagttatgtgggtttaactgaacctgctgcaaaggaattaggacaaacagaa
gggtttgaaattgcaacggtaaaaacctattttaagggtaattctaaagcaattgcggag
ggagaaaccgaaggtatggctaaagtgatttatcggaaagatacgggggaaattttagga
gttcatatctttggtcttcatgcttctgatttaattcaagaagcggcaaatgctatgtat
caccgtcaatctgtccatgatttagtcttctcagttcatacccatcctaccctttcagaa
gtgcttgatgaagcctacaaacgggctgtttttagtgtggggggtcattag

DBGET integrated database retrieval system