KEGG   Pteropus alecto (black flying fox): 102879479
Entry
102879479         CDS       T02993                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale03420  Nucleotide excision repair
pale04115  p53 signaling pathway
pale04120  Ubiquitin mediated proteolysis
pale05161  Hepatitis B
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05216  Thyroid cancer
pale05217  Basal cell carcinoma
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102879479 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    102879479 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102879479 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102879479 (DDB2)
   05202 Transcriptional misregulation in cancer
    102879479 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102879479 (DDB2)
   05212 Pancreatic cancer
    102879479 (DDB2)
   05225 Hepatocellular carcinoma
    102879479 (DDB2)
   05226 Gastric cancer
    102879479 (DDB2)
   05214 Glioma
    102879479 (DDB2)
   05216 Thyroid cancer
    102879479 (DDB2)
   05220 Chronic myeloid leukemia
    102879479 (DDB2)
   05217 Basal cell carcinoma
    102879479 (DDB2)
   05218 Melanoma
    102879479 (DDB2)
   05213 Endometrial cancer
    102879479 (DDB2)
   05224 Breast cancer
    102879479 (DDB2)
   05222 Small cell lung cancer
    102879479 (DDB2)
   05223 Non-small cell lung cancer
    102879479 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102879479 (DDB2)
   05169 Epstein-Barr virus infection
    102879479 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102879479 (DDB2)
   03400 DNA repair and recombination proteins [BR:pale03400]
    102879479 (DDB2)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     102879479 (DDB2)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      102879479 (DDB2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 102879479
NCBI-ProteinID: XP_024899880
LinkDB
Position
Unknown
AA seq 427 aa
MASRKRPETRKTPEVVVRRKSKRNRSPRELEPEAKKLCVKGPGSSRRFDSGCLWAGLASL
QVSPPCRNIVRALYHHKVGKAAWPSLQQSLQHSFLQSLASYRIFQKAAPFDRRATSLAWH
PTHPSTLAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFFTSSMEGM
TRLQDFKGNTLQVFASYSICNFWFCSLDVSAKSRVVVTGDNVGNVILLSMDGKELWNLRM
HKKKVTHLALNPCCDWFLATASVDQTVKIWDLRQVKGKSSFLYSLPHRHPVNAAHFSPDG
AQLLTTDQNSEIRVYSASQWDCPPSLIPHPHRHFQHLTPIKAAWHPRYNFIVVGRYPDPN
FKSCTPYELRTIDVFDGSSGKLMHQLYDPESSGIISLNEFNPMGDTLASLMGYHILIWSQ
EEAGMQK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggcttccaggaaacgcccagaaacccggaagacccctgaggtggtcgtgcgccgcaag
agcaagaggaacagaagcccccgagagttggagcccgaggccaagaagctctgtgtgaag
ggccccggttctagcagaagatttgactcaggctgcctttgggcggggttggctagcctg
caggtctcaccaccatgcaggaatatcgtcagggccctctatcaccataaagtgggcaaa
gctgcttggccatcactacagcagagtctccagcattcctttttgcagtctctggcttct
taccggatattccaaaaggctgccccctttgacaggagggccacatccttggcatggcac
ccaactcaccccagcaccctggctgtaggttccaaagggggagatatcatgctctggaac
tttggcataaaggacaaacctaccttcattaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagtttttcacctcctcaatggagggaatg
actaggctacaagactttaaaggcaacactctccaagtttttgccagctacagcatctgc
aacttctggttttgcagcctggatgtgtctgccaaaagccgagtggtggtcacaggagac
aatgtagggaacgtgatcctgctgagcatggacggcaaggagctttggaatctgagaatg
cacaaaaagaaagtgacccatttggccctgaacccatgctgtgattggttcctggccaca
gcctctgtagatcaaacagtgaaaatctgggacctgcgccaggttaaagggaaatccagc
ttcctctactcactgccacacaggcatcctgtcaacgcagctcatttcagtcccgatgga
gcccagctgctgaccactgaccagaacagtgagatccgggtttactctgcctcccagtgg
gactgccccccgagcctgatcccgcaccctcaccgccacttccagcacctgacgcccatc
aaggcagcctggcatcctcggtacaacttcattgttgtgggccgatacccagatcctaat
ttcaaaagttgtaccccctatgaattaaggacaatcgatgtatttgatggaagctcaggg
aagttgatgcatcagctctatgacccagaatcttctggaatcatttcgctcaatgagttc
aatcctatgggagacacgctggcttctttgatgggttatcacattctcatttggagccaa
gaggaagctgggatgcagaaatga

DBGET integrated database retrieval system