KEGG   Pteropus alecto (black flying fox): 102882795
Entry
102882795         CDS       T02993                                 

Definition
(RefSeq) glutathione S-transferase theta-4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102882795
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102882795
   00982 Drug metabolism - cytochrome P450
    102882795
   00983 Drug metabolism - other enzymes
    102882795
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102882795
   05204 Chemical carcinogenesis
    102882795
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102882795
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102882795
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102882795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102882795
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102882795
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102882795
SSDB
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2
Other DBs
NCBI-GeneID: 102882795
NCBI-ProteinID: XP_015442372
UniProt: L5KWN0
LinkDB
Position
Unknown
AA seq 241 aa
MGLELYLDLLSASCRAVYIFARKNSIPFDFQFVDLLKGQHHSKEYTEINPLKKLPSLRDG
KFVLSESAAILLYLCRKYSTPSHWYPPDLHMRARVDEFMAWQHTAIQMPMNKILWIKLLI
PMITGEEVPAEKTEEMIAEANKNLQLFEEKFLQDRMFITGDHISLADLVALVQMMQPIGS
NHDVFLNSSKLAEWRMRVELAIGSGLFWEAHDRLVKLVEWDCSTLDPMVKERICDLLHKF
K
NT seq 726 nt   +upstreamnt  +downstreamnt
atgggcctggagctctacctggacctgctgtcagcatcctgccgcgccgtctacatcttc
gccagaaagaacagcatccccttcgactttcagtttgtggatctgctgaaaggtcagcat
cacagcaaggaatatactgagatcaatcccctgaagaagctgcccagcctcagagatgga
aaattcgtcttatctgaaagcgcggccatcctcttgtacttgtgccgcaagtacagcacc
ccctcgcactggtacccaccagacctgcacatgcgcgcccgtgtggatgagttcatggcc
tggcagcacacggccattcaaatgcccatgaacaagatactttggatcaagctgctgatc
ccgatgatcacaggtgaggaggttccagctgagaagacagaggagatgatagcagaggca
aacaaaaacctgcagctcttcgaggagaagtttctgcaggacagaatgttcatcactggg
gaccacatctcactggctgacttggtggccctggtgcagatgatgcagcccatagggagc
aaccacgatgtcttcctcaacagctccaagctggcagagtggcgcatgagggtggagctg
gccattggctctggcctcttctgggaggcccatgaccggctggtgaagttggtagagtgg
gactgttcaacgttggatccaatggtcaaggagaggatctgtgacttgctacacaagttc
aagtag

KEGG   Pteropus alecto (black flying fox): 102883042
Entry
102883042         CDS       T02993                                 

Definition
(RefSeq) glutathione S-transferase theta-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102883042
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102883042
   00982 Drug metabolism - cytochrome P450
    102883042
   00983 Drug metabolism - other enzymes
    102883042
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102883042
   05204 Chemical carcinogenesis
    102883042
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102883042
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102883042
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102883042
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102883042
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102883042
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102883042
SSDB
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_N_4 GST_C_2
Other DBs
NCBI-GeneID: 102883042
NCBI-ProteinID: XP_006908737
LinkDB
Position
Unknown
AA seq 240 aa
MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSNAFAQVNPLKKVPALKDG
DFILTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRNCLRALWHKAMF
SVFLGEPVSPEMLAATLAELDVTLKILEDKFLQKNAFLSGPYISLADLVAITELMHVSTV
GKVGPLGRPKLAAWRQRVEAAVGKILFQEAHETILNVKNFPPADPVIKQKLMPGILAMIQ
NT seq 723 nt   +upstreamnt  +downstreamnt
atgggcctggagctctacctggacctgctgtcccagccctgccgcgctgtctacatcttc
gccaagaagaacggcatcccctttgagctgcgcaccgtggagctgctcaaaggccagcat
ctcagcaatgcctttgcccaggtgaaccccttgaagaaagtgcctgccttgaaggatggg
gacttcatcttgactgagagtgtggccatattgctctacctgacccgcaagtataaggtc
cctgaccactggtaccctcaggacctgcaggcccgtgcccgtgtggatgagtacctggca
tggcagcacacaaccctgcggagaaactgcctccgggccctgtggcataaggcgatgttc
tctgttttcctgggtgagccagtatctcctgaaatgctggcagccacactagcagagttg
gatgtgaccttgaagatacttgaggacaagttcctccagaagaatgcttttctgtccggg
ccctacatttccctggctgacctggtagccatcacggagctgatgcatgtgagtactgtg
ggcaaggtaggcccacttggcagacccaagctggctgcttggcgccagcgcgtggaagca
gcagtgggaaagatcctcttccaagaggcccatgagaccatcctgaatgtcaagaacttt
ccacctgcagaccccgtcataaagcagaagctgatgcctgggatactggccatgatccaa
tga

KEGG   Pteropus alecto (black flying fox): 102883292
Entry
102883292         CDS       T02993                                 

Definition
(RefSeq) glutathione S-transferase theta-3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102883292
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102883292
   00982 Drug metabolism - cytochrome P450
    102883292
   00983 Drug metabolism - other enzymes
    102883292
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102883292
   05204 Chemical carcinogenesis
    102883292
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102883292
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102883292
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102883292
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102883292
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102883292
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102883292
SSDB
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 GST_N_4
Other DBs
NCBI-GeneID: 102883292
NCBI-ProteinID: XP_006908738
UniProt: L5KW11
LinkDB
Position
Unknown
AA seq 240 aa
MSLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQQHSNAFAQVNPLKKVPALKDG
DFTLAESVAILLYLSRKYKAPDHWYPQDLQACARVDEYLAWQHTALRSSCTRAMWQKMLF
PVFLGEQVPPEMLASTLAELDRCLQLLEDKFLKDQDFLAGPHISVADLVAITELMHPVSA
GCQVFKSRPKLAAWHKRVEAAVGEDLFQEAHAAVMKAKDMPPADTATKERLKPLAQFLLK
NT seq 723 nt   +upstreamnt  +downstreamnt
atgagcctggagctctacctggacctcctgtcccagccctgccgcgccgtctacatattc
gccaagaaaaacggcatccccttcgagctccgcaccgtggatctgctcaaaggccagcag
cacagcaatgcctttgcccaggtgaaccccctgaagaaagtgccagccttgaaggatggg
gactttaccttggctgagagtgtggccatcttgctgtatctgagccgcaagtacaaggcc
cctgaccactggtacccccaggacctgcaggcctgcgcccgtgtggacgagtacttggcg
tggcagcacacggccctgcggagtagctgcacccgagccatgtggcagaagatgctgttc
cctgtgttcctgggtgaacaggtgccccctgaaatgttagcgtcgactctggctgagctg
gacaggtgcctacagctgcttgaggacaagttcctgaaggaccaggatttccttgctggg
cctcatatctcagtggctgacttggtagccatcacagagctgatgcatcctgtcagtgct
ggctgccaagtcttcaaaagccgacccaagctggctgcctggcataagcgtgtggaggcc
gcagtgggagaggacctcttccaggaggcccatgctgctgtcatgaaggccaaggacatg
cctccagcggacactgccacaaaggagaggctgaagcccttggcgcagtttttattgaag
tga

KEGG   Pteropus alecto (black flying fox): 102885225
Entry
102885225         CDS       T02993                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102885225 (MGST2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102885225 (MGST2)
   00982 Drug metabolism - cytochrome P450
    102885225 (MGST2)
   00983 Drug metabolism - other enzymes
    102885225 (MGST2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885225 (MGST2)
   05204 Chemical carcinogenesis
    102885225 (MGST2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102885225 (MGST2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102885225 (MGST2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102885225 (MGST2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102885225 (MGST2)
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102885225 (MGST2)
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102885225 (MGST2)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 102885225
NCBI-ProteinID: XP_006906283
LinkDB
Position
Unknown
AA seq 111 aa
MPPAVSGSPEFERIFRAQQNCVEFYPVFLITLWMAGWYFHQVFATCLGLVYIYERYQYFW
GYSEDANKRLTGFRLSLGILALLAVLGSLGIANSFLDEYLHLNIAKKLRHF
NT seq 336 nt   +upstreamnt  +downstreamnt
atgcctccagcagtctctgggtcaccagagtttgagagaatatttcgtgcacaacaaaac
tgtgtggaattttaccccgtattcctgattacattgtggatggctggttggtatttccac
caagtttttgctacctgtctgggtctggtgtatatatatgaacgttaccagtatttctgg
ggatattcagaagatgctaacaaaagattgactggtttccggttgagtctggggattttg
gccttgctggctgtcctaggctccctggggattgcaaacagctttctggatgaatacctg
cacctcaatattgccaagaagctgaggcacttctag

KEGG   Pteropus alecto (black flying fox): 102886852
Entry
102886852         CDS       T02993                                 

Gene name
GSTO2
Definition
(RefSeq) glutathione S-transferase omega-2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102886852 (GSTO2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102886852 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    102886852 (GSTO2)
   00983 Drug metabolism - other enzymes
    102886852 (GSTO2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102886852 (GSTO2)
   05204 Chemical carcinogenesis
    102886852 (GSTO2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102886852 (GSTO2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102886852 (GSTO2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102886852 (GSTO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102886852 (GSTO2)
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102886852 (GSTO2)
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102886852 (GSTO2)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C
Other DBs
NCBI-GeneID: 102886852
NCBI-ProteinID: XP_006920943
LinkDB
Position
Unknown
AA seq 244 aa
MSDDASRSLGKGSIPPGPVPEGLIRVYSNRFCPYAHRTRLVLQAKGIRHEVININLRNKP
EWYYSKHPFGQIPVLENSRCQLIYESVIACEYLDDAYPGRKLYPFDPYERARQKMLLELF
YKVPHLTKECLVALRYGRECADLKLALRQEFCNLEEILDYQNTVFFGGDCISMIDYLFWP
WFERLDVYGIADCVNHTPALRLWISAMKQDPAVCSLIIDKNIFLGFLNLYFQNHPDAFDY
GLSC
NT seq 735 nt   +upstreamnt  +downstreamnt
atgagtgatgatgcgagcaggtccttggggaaaggaagcatccccccagggccggtccca
gagggcctgatccgcgtctacagcaataggttctgcccttacgcacaccggacacgcctt
gtcctccaggccaaaggcatcagacatgaagttatcaacattaatctgagaaacaagcct
gaatggtactattcaaagcacccttttggccaaattcctgtcttggaaaacagcagatgt
caactgatctatgaatctgtcatcgcttgtgagtacctggatgatgcttatcctggaagg
aagctgtatccatttgacccttatgagcgggctcgacaaaagatgttattggagctattc
tataaggtcccacatttgaccaaggagtgtctggtagcattgagatacgggagagaatgt
gctgatctgaagctagcccttcgtcaggaattctgcaaccttgaagagattcttgactat
cagaacaccgtcttctttggtggagactgtatatccatgatcgattacctcttttggccc
tggtttgagcggctggatgtatacggaatagctgactgtgtgaaccacaccccggcactt
cggctctggatatcagccatgaagcaggaccctgcagtgtgttctcttatcatcgataag
aacatttttctgggtttcttgaatctctattttcagaaccaccctgatgcctttgactat
gggctgagttgctga

KEGG   Pteropus alecto (black flying fox): 102887110
Entry
102887110         CDS       T02993                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102887110 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102887110 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    102887110 (GSTO1)
   00983 Drug metabolism - other enzymes
    102887110 (GSTO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102887110 (GSTO1)
   05204 Chemical carcinogenesis
    102887110 (GSTO1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102887110 (GSTO1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102887110 (GSTO1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102887110 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102887110 (GSTO1)
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102887110 (GSTO1)
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102887110 (GSTO1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin GST_N_4 GST_C_5
Other DBs
NCBI-GeneID: 102887110
NCBI-ProteinID: XP_006920944
UniProt: L5K2K3
LinkDB
Position
Unknown
AA seq 241 aa
MSGASARSLEKGSAPPGPVPEGLIRLYSMRFCPYAQRTRLVLKAKGIRHEIININLKNKP
EWFFKKNPFGLVPVLENSKGQLVCDSAIICEYLDEAYPGKKLLPEDPYEKACQKMSFELF
SKVPSLEGSYIRNKNKEDCSGIKEELRKEFSKLEEVLTNKKTTFFGGNSLSMIDYLIWPW
FECLEALELSECVDHTPKLKLWMAAMREDPTVSALLTDVKTFRGCLDLYLQNSVEACDYG
L
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtccggagcatcagccaggagcctggagaaagggagtgcgcccccaggaccggtcccg
gagggcctgatccgcctctatagcatgaggttctgcccctacgcccagaggacgcgcctt
gtcctgaaggccaagggaatccggcatgaaatcatcaacattaacctgaaaaataagcct
gagtggttctttaagaagaatccctttggtctggtgccagttctggaaaacagtaagggt
caactggtctgtgactctgccatcatttgtgagtacctggatgaagcatatccagggaag
aagctgttgccagaagacccttatgagaaagcatgccaaaagatgtcctttgagttattt
tcaaaggtaccatctttggaaggaagctatattagaaataaaaataaggaagactgctct
ggcataaaagaagaacttcgcaaagaattcagcaagcttgaggaggttctgaccaataag
aaaacaaccttctttggtggcaattcactttccatgattgattacctcatctggccctgg
tttgaatgtctggaagcactggagttaagcgagtgtgtagaccacactccaaaacttaag
ctctggatggcagccatgagggaagatcccacagtatcagccctcctcactgatgtgaag
acctttcgaggttgcttagatctctacttgcagaatagcgtagaggcctgtgactacggg
ctctga

KEGG   Pteropus alecto (black flying fox): 102887332
Entry
102887332         CDS       T02993                                 

Gene name
MGST1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102887332 (MGST1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102887332 (MGST1)
   00982 Drug metabolism - cytochrome P450
    102887332 (MGST1)
   00983 Drug metabolism - other enzymes
    102887332 (MGST1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102887332 (MGST1)
   05204 Chemical carcinogenesis
    102887332 (MGST1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102887332 (MGST1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102887332 (MGST1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102887332 (MGST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102887332 (MGST1)
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102887332 (MGST1)
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102887332 (MGST1)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 102887332
NCBI-ProteinID: XP_006912721
LinkDB
Position
Unknown
AA seq 156 aa
MVDLTQLMENEVFMSFASYTTIILSKMMFMSIVTAFYRLTRKVFTNPEDSVVFGGKGENA
KKYLRTDDNVERVRRAHLNDLENIVPFFGIGLLYSLSDPDLSTAILHFRLFLGARIYHTV
AYLLPLPQPNRAFSFFVGYGVTLSMAYRLLKSRLYL
NT seq 471 nt   +upstreamnt  +downstreamnt
atggttgatctcacccagctaatggaaaatgaagtattcatgtcctttgcctcctataca
acgattatactttcaaaaatgatgtttatgagcattgtaactgcattctacagattgaca
agaaaggtttttaccaacccagaagactctgtagtctttgggggaaaaggagaaaatgcc
aagaagtatcttcggacagatgacaacgtggaacgtgtacgaagggcgcacctgaatgac
cttgaaaatatcgtgccattttttggtatcggcctcctatattccttgagtgatccagat
ctctctacagccatcctgcacttcaggctctttcttggagcacggatctatcatacagtt
gcatatttgttacctcttccccagccaaatcgtgctttttctttttttgttggatatgga
gttactctttcgatggcttacagattgctgaagagcagattgtacctgtaa

KEGG   Pteropus alecto (black flying fox): 102889068
Entry
102889068         CDS       T02993                                 

Definition
(RefSeq) glutathione S-transferase P isoform X2
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05215  Prostate cancer
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102889068
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102889068
   00982 Drug metabolism - cytochrome P450
    102889068
   00983 Drug metabolism - other enzymes
    102889068
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102889068
   05204 Chemical carcinogenesis
    102889068
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102889068
   05215 Prostate cancer
    102889068
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102889068
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102889068
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102889068
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102889068
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102889068
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 102889068
NCBI-ProteinID: XP_006911075
LinkDB
Position
Unknown
AA seq 193 aa
MRMLLADQGQSWKEEVVTKETWLQGPLKASCLFGQLPKLQDGDLTLYQSNAILRHLGRSF
GLYGKDQREAALVDMVNDGVADLRNLCGHLIHHDCEEDKARYMRDLPEHLKPFETLLAQN
QGGQAFIVGNQISFADYNLLDLLLTHQVLTPGCLDAFPLLSAYVARLSARPKLKAFLASP
EHVNRPVFGSRKT
NT seq 582 nt   +upstreamnt  +downstreamnt
atgcgcatgctgctggctgaccagggccagagctggaaagaggaggtggtgaccaaggag
acctggctgcagggccctctcaaggcctcctgtctgttcgggcagctccccaagctccag
gatggagacctcactctgtaccagtccaatgccatcctccgccacctgggccgctccttc
gggctctacggcaaagaccagcgggaggcggcgctggtggacatggtgaacgacggtgtg
gcggacctccgcaacctctgcggccacctcatccaccacgactgtgaggaggacaaggcc
cggtacatgcgggacctgccagagcacctgaagccttttgagacgctgctggcccagaac
caggggggccaggccttcattgtgggcaaccagatctccttcgccgactacaacctgctc
gacttgctgctgacccaccaggtcctgacccccggctgcctggacgccttccccttgctc
tcggcctacgtggcccgcctcagtgcccggcccaagctcaaggccttcctggcctcccct
gagcacgtgaaccgccctgtctttggaagccgcaagacatga

KEGG   Pteropus alecto (black flying fox): 102891202
Entry
102891202         CDS       T02993                                 

Gene name
MGST3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102891202 (MGST3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102891202 (MGST3)
   00982 Drug metabolism - cytochrome P450
    102891202 (MGST3)
   00983 Drug metabolism - other enzymes
    102891202 (MGST3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102891202 (MGST3)
   05204 Chemical carcinogenesis
    102891202 (MGST3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102891202 (MGST3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102891202 (MGST3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102891202 (MGST3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102891202 (MGST3)
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102891202 (MGST3)
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102891202 (MGST3)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 102891202
NCBI-ProteinID: XP_006907897
LinkDB
Position
Unknown
AA seq 152 aa
MAVLSKEYGFVVLTGAASFIMVGHLAFNVSKARKKYKVEYPTMYSADPENGHLFNCIQRA
HQNTLEAYPAFLFFLAVGGVYHPRVASGLGLAWIVGRVLYAYGYYTGDPSKRSRGALGSV
ALLGLLGTTVVSAFQHLGWLRPGLGSECKSCH
NT seq 459 nt   +upstreamnt  +downstreamnt
atggccgtcctctccaaggagtatggcttcgtggtgctgacgggggccgccagcttcatc
atggtcggccatctggccttcaatgtgtccaaggcccgcaagaagtacaaggtggagtac
cccaccatgtacagcgcagaccccgagaacggacacctgttcaactgcattcagcgagcc
caccagaacacgttggaagcgtatccggccttcttgttttttctagctgttgggggtgtt
taccacccgcgagtagcttccggtttgggcctggcctggattgtcggacgggttctctac
gcctacggctattacacaggagaccctagcaagcggagccggggggcgctgggctccgtc
gcccttctcggcttactgggcaccaccgtggtctcggccttccagcacctcggctggctt
agacctggcttgggcagtgagtgcaaatcctgccattaa

KEGG   Pteropus alecto (black flying fox): 102891351
Entry
102891351         CDS       T02993                                 

Gene name
GSTA4
Definition
(RefSeq) glutathione S-transferase A4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102891351 (GSTA4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102891351 (GSTA4)
   00982 Drug metabolism - cytochrome P450
    102891351 (GSTA4)
   00983 Drug metabolism - other enzymes
    102891351 (GSTA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102891351 (GSTA4)
   05204 Chemical carcinogenesis
    102891351 (GSTA4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102891351 (GSTA4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102891351 (GSTA4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102891351 (GSTA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102891351 (GSTA4)
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102891351 (GSTA4)
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102891351 (GSTA4)
SSDB
Motif
Pfam: GST_C_3 GST_N GST_C GST_C_2 GST_N_3 CbeA_antitoxin
Other DBs
NCBI-GeneID: 102891351
NCBI-ProteinID: XP_006926883
LinkDB
Position
Unknown
AA seq 218 aa
MAEKPKLHYPNGRGRMETVRWVLAAAGVEFDEEFLETKEQLQKLQDGNHLLFQQVPMVEI
DGMKLVQTRSILHYIADRHHLFGKDLKERTLIDMYVEGTLDLLELIIMHPFLKPDDQQKE
VVNMAQKAIIRYFPVFEKVLREHGQRFLVGNQLSLADIILLQTILALEEKIPNILSSFPH
LQEYTVKMSNIPTIKKFLEPGSKKKPPPDEIYVRTVYN
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcagagaagcccaagctccactatccaaatggaagaggtcggatggaaaccgtaaga
tgggttttagctgccgctggagtggagtttgatgaagaatttttagaaacaaaagaacag
ttgcagaagttgcaggatggtaaccacctgctgttccaacaagtgccaatggttgaaatt
gacgggatgaagttggtgcagacccgaagcattctccactacatagcggacaggcaccat
ctctttggcaaggacctcaaggagagaaccctgattgacatgtatgtggaggggacgctg
gatctgctggaactgattatcatgcatcctttcctaaaaccagacgatcaacagaaggaa
gtggttaacatggctcagaaggctataattagatactttcctgtgtttgaaaaggttcta
agggaacatggacaaaggtttcttgttggtaatcagctgagccttgcagatataattcta
ctccaaaccattttggctctagaggagaaaattcctaatatcctgtcatcatttcctcac
ctccaggagtacacagtgaaaatgagtaatattcccacaattaagaaattccttgaacct
ggcagcaagaagaagcctcctccagatgaaatctatgtgagaaccgtttacaac

KEGG   Pteropus alecto (black flying fox): 102891589
Entry
102891589         CDS       T02993                                 

Definition
(RefSeq) glutathione S-transferase A4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102891589
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102891589
   00982 Drug metabolism - cytochrome P450
    102891589
   00983 Drug metabolism - other enzymes
    102891589
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102891589
   05204 Chemical carcinogenesis
    102891589
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102891589
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102891589
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102891589
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102891589
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102891589
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102891589
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 102891589
NCBI-ProteinID: XP_024898601
LinkDB
Position
Unknown
AA seq 170 aa
MEEWGSEKQTYLYVPIRKALFNSQNPEPEVMVAKPKLYYFRGRGRMESIRWLLAAAGVEL
GSLVGKEGGLKKNFLKQESSMRSCRRILKDHGEDFLVGNKFSWADIQLLETILMVEELNA
SVLSDFPLLKAFKTRISNIPTIKKFLQLGSQKKLPPDSHYVEVVRNILQF
NT seq 513 nt   +upstreamnt  +downstreamnt
atggaggagtggggctcggaaaaacaaacatatttatatgtacccatccgtaaggctctg
ttcaattcccaaaaccctgagccagaagtcatggtagccaaacccaagctttactacttt
cgtggcaggggcaggatggagtcaatccgctggctgctggctgcagctggagtggagcta
ggttccttggttggaaaggaaggaggtttgaagaagaatttcttgaaacaagagagcagt
atgagaagttgcagaaggattttgaaagaccatggagaggattttctcgttggcaataaa
ttcagttgggcagacatacaactgttggaaactattttaatggtcgaagaacttaatgct
tctgttctttcagacttccctctgctaaaggcatttaaaacaagaatcagcaacatccct
acaattaagaagttcctacagctgggaagtcaaaagaagctgcccccggatagccactat
gtcgaagtagtcaggaacattctgcagttctaa

KEGG   Pteropus alecto (black flying fox): 102893685
Entry
102893685         CDS       T02993                                 

Gene name
GSTM4
Definition
(RefSeq) glutathione S-transferase Mu 4 isoform X3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102893685 (GSTM4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102893685 (GSTM4)
   00982 Drug metabolism - cytochrome P450
    102893685 (GSTM4)
   00983 Drug metabolism - other enzymes
    102893685 (GSTM4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102893685 (GSTM4)
   05204 Chemical carcinogenesis
    102893685 (GSTM4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102893685 (GSTM4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102893685 (GSTM4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102893685 (GSTM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102893685 (GSTM4)
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102893685 (GSTM4)
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102893685 (GSTM4)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_N_3 GST_C_2 WD40_alt
Other DBs
NCBI-GeneID: 102893685
NCBI-ProteinID: XP_006919672
UniProt: L5K3H4
LinkDB
Position
Unknown
AA seq 218 aa
MTMTLGYWDIRGLAHAIRLLLEYTASNYEEKKYTMGDAPDYDRSQWLSEKFQLGLDFPNL
PYLIDGSHRLTQSNAILRYIARKHNLCGETEEEKIRVDILENEVMDVSNQLAGVCYSPDF
EKLKPEYLKALPEKMKLFSQFLGKRSWFAADKPTYVDFLAYDILDLHRIFEPKYLDAFPN
LKDFVVRLEGLEKISAYMKSSRFIPSPLYTKIAVWGNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgaccatgactttgggttactgggatatccgcgggctggctcacgccatccgcctgctc
ctggagtacacagcctccaactatgaggagaagaagtacacgatgggggacgctcccgac
tatgacagaagccagtggctgagcgaaaaattccagctgggcctcgacttccccaatctg
ccctacttaattgacgggtctcacaggctcacccagagcaacgccatccttcgctacatt
gctcgcaagcacaacctatgtggggagacagaagaggagaagattcgtgtggacattttg
gagaatgaggttatggacgtatccaatcagctggctggagtctgctatagccctgacttt
gagaaactgaagcctgagtacttgaaggcactccccgaaaagatgaagctcttctcacag
tttctggggaagaggtcttggtttgcagcggacaagcccacctatgtggatttcctggct
tatgacatcctagacctgcaccgtatatttgagcccaagtacctggacgcgttcccaaac
ctgaaggactttgtggtccgcttagagggcctggagaagatctccgcctacatgaagtcc
agtcgtttcatcccaagtcctttgtatacaaagattgcagtgtggggcaacaagtag

KEGG   Pteropus alecto (black flying fox): 102894088
Entry
102894088         CDS       T02993                                 

Definition
(RefSeq) glutathione S-transferase Mu 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102894088
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102894088
   00982 Drug metabolism - cytochrome P450
    102894088
   00983 Drug metabolism - other enzymes
    102894088
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102894088
   05204 Chemical carcinogenesis
    102894088
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102894088
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102894088
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102894088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102894088
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102894088
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102894088
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3 GST_C_6
Other DBs
NCBI-GeneID: 102894088
NCBI-ProteinID: XP_006919673
UniProt: L5K5Y6
LinkDB
Position
Unknown
AA seq 226 aa
MSSSKSAVVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDL
DFPNLPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLTRLC
YNPDHEKLKPQYLEQLPVQLKQFSLFLGKFSWFAGEKLTFVDFLTYDVLDQNRMFEPKCL
EEFPNLKAFMCRFEALEKIAAYMQSDRFFKMPINNKMAQWGQKRTC
NT seq 681 nt   +upstreamnt  +downstreamnt
atgtcgtcgtccaagtcggctgtggttctcggttactgggatattcgcgggctggcgcac
gccatccgcttgctcctggagttcaccgatacttcctacgaggagaaacggtacacgtgt
ggggaagctcccgactatgatagaagccagtggctggacgtgaaattcaagctggacctg
gacttccctaacctgccatacctcatggacggtaagaataagatcacccagagcaatgcc
atcttgcgctacatcgctcgcaagcacaatatgtgcggtgatactgaagaagaaaagatt
cgagtggacattatggagaaccaaataatggacttccgcatgcagctaacacgactctgc
tacaaccctgaccatgaaaaattgaagcctcaatacttggaacagctgcctgtacaactg
aaacaattctccttgttcctggggaaattctcatggtttgcaggagaaaagctcaccttt
gtggattttctcacctatgatgtcttagatcagaaccgcatgtttgagcccaagtgcctg
gaggaatttccaaatctgaaggctttcatgtgccgttttgaggctttagagaaaatcgct
gcctacatgcaatctgaccgtttcttcaaaatgcccatcaacaacaagatggctcagtgg
ggccaaaagagaacatgctga

KEGG   Pteropus alecto (black flying fox): 102896271
Entry
102896271         CDS       T02993                                 

Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05215  Prostate cancer
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102896271
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102896271
   00982 Drug metabolism - cytochrome P450
    102896271
   00983 Drug metabolism - other enzymes
    102896271
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102896271
   05204 Chemical carcinogenesis
    102896271
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102896271
   05215 Prostate cancer
    102896271
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102896271
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102896271
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102896271
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102896271
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102896271
SSDB
Motif
Pfam: GST_C_3 GST_N GST_N_3
Other DBs
NCBI-GeneID: 102896271
NCBI-ProteinID: XP_024902064
LinkDB
Position
Unknown
AA seq 231 aa
MPPYTIIYFPVQGRCEAMRMLLADQGQSWKEEVVTKETWLQGPVKASCLYGQLPKFQDGD
LTLYQSNAILRHLGRSLGLYGKDQREAALVDMVNDGVEDLRSKYGTFIYTNYVSMGTRGR
HVGPTKYYVKELPEHLKPFETLLAQNQGGQAFIVGNQVSGRPCPTPAMPPSSYRWETGAE
RAREPFVAGWTLDSFPLLSAYVARLSARPKLKAFLASPEHVNRPINGNNKQ
NT seq 696 nt   +upstreamnt  +downstreamnt
atgccgccctacaccatcatctacttccccgtccaagggcgctgcgaggccatgcgcatg
ctgctggctgaccagggccagagctggaaagaggaggtggtgaccaaggagacctggctg
cagggccctgttaaggcctcctgcctgtatggacagctccccaagttccaggatggagac
ctcaccctataccagtccaatgccatcctgcgccacctgggacgctccctggggctgtat
gggaaggaccagcgggaggcggccctggtggacatggtaaatgacggcgtggaggacctc
cgcagcaaatacggcaccttcatctacaccaactacgtgagcatgggcaccaggggcagg
cacgtgggaccaacaaagtactatgtgaaggagctgccagagcacctgaagccctttgag
acgctgctggcccagaaccaggggggccaggccttcatcgtgggcaaccaggtgagtggc
cgtccctgtcctacccctgcaatgccaccctcttcttacagatgggagacaggtgcagag
agagcacgtgagccatttgttgctgggtggaccttggactccttccccttgctctcggcc
tatgtggctcgcctcagtgcccggcccaagctcaaggccttcctggcctcccccgagcat
gtaaaccggcccatcaatggcaacaacaaacagtga

KEGG   Pteropus alecto (black flying fox): 102897012
Entry
102897012         CDS       T02993                                 

Definition
(RefSeq) glutathione S-transferase A3-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102897012
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102897012
   00982 Drug metabolism - cytochrome P450
    102897012
   00983 Drug metabolism - other enzymes
    102897012
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102897012
   05204 Chemical carcinogenesis
    102897012
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102897012
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102897012
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102897012
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102897012
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102897012
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   102897012
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_N_3
Other DBs
NCBI-GeneID: 102897012
NCBI-ProteinID: XP_024898602
LinkDB
Position
Unknown
AA seq 295 aa
MAVMIHTVLAVPMESSLWAHCLTSRGNSGCPRELQKLTPTELSNIQGPTSTSPGNLRFEQ
KEKGLEKPGDYIMAGKPKLHYFNARGRMESIRWLLAAAGVEFEEKFIETLEDFEKLKKDS
GLIFQQVPMVEIDGMKLVQSRAILNYIATKYNLYGKDIKERALIDMYTEGMADLNEMILT
LLLCPPNEIDAKIALIKEKVTTRYFPAFEKVLKSHGQDYLVGNKLSRADIYLVELFYYVE
EIDPSLLANFPLLKALKTRISNLPTVKKFLQPGSQRKPPTDAKTLEEVKKIFNIK
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcagtcatgatccacacggtgttggccgtgccgatggagagttctctttgggcccac
tgcctgactagtcgaggtaactctgggtgcccaagggagcttcagaaactgaccccaaca
gagctcagcaacattcaaggcccaacttctacgtcaccagggaaccttagatttgaacag
aaagagaagggtttagagaaaccaggagactacatcatggcggggaaacccaagcttcac
tacttcaatgcacgaggacgaatggagtccatccggtggctcttggctgctgcaggagta
gagtttgaagagaaatttatagaaactctagaagactttgaaaagttaaaaaaagatagc
ggtttgatattccagcaagtgcccatggtcgaaattgatggaatgaagctggtacagtcc
agagccattctcaactacatcgccaccaaatacaacctctatgggaaagacataaaggag
agagccctgattgatatgtatacagaaggcatggcagatttgaatgaaatgatcctgact
ttgctactatgcccgcccaacgagatagatgccaagatcgccttgatcaaagagaaagta
accacccgttatttccctgcctttgaaaaagtgttgaagagccacggacaagactacctg
gttggcaacaagttgagcagggctgacatttacctggttgaacttttctactatgtggaa
gagattgaccccagccttctggccaacttccctctgctgaaggccctgaaaaccagaatc
agcaacctccctactgtgaagaagttcctgcagcctggcagccagaggaagcctcccacg
gatgcgaaaacactagaagaagtcaaaaagattttcaatattaaatag

KEGG   Pteropus alecto (black flying fox): 107195441
Entry
107195441         CDS       T02993                                 

Definition
(RefSeq) glutathione S-transferase theta-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale00983  Drug metabolism - other enzymes
pale01100  Metabolic pathways
pale01524  Platinum drug resistance
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05225  Hepatocellular carcinoma
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107195441
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107195441
   00982 Drug metabolism - cytochrome P450
    107195441
   00983 Drug metabolism - other enzymes
    107195441
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107195441
   05204 Chemical carcinogenesis
    107195441
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107195441
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107195441
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107195441
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    107195441
Enzymes [BR:pale01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107195441
Transporters [BR:pale02000]
 Other transporters
  Pores ion channels [TC:1]
   107195441
SSDB
Motif
Pfam: GST_N GST_N_3 GST_N_2 nos_propeller_2
Other DBs
NCBI-GeneID: 107195441
NCBI-ProteinID: XP_015442274
LinkDB
Position
Unknown
AA seq 212 aa
MALELFLDLYLTLSYAIYIFAKNNGIMASVSTEAHGAGTGKHPKSEFLKANSLEKVPALR
DGNFLLAESVAILLYLSYKYQIDTHWYPPQLQACTHIREYRVWQHTAIQQPSTNVYLCKS
FLPHFLGQPVDATQLVQLLGRLMSALQHQDPEALVAKPFLVTEQVSLVEPTVLTERMQEA
HRLVLQPWEPQEAQQEPQLAQELVPRLQERLH
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcacttgagctttttctggacctgtacttgaccctgagctatgccatctacattttt
gctaagaataatggcattatggcatccgtttcaactgaagcccacggagctggcacgggg
aagcacccgaaatcagaattcctgaaggcgaactccctggagaaggtgcctgccctcagg
gatgggaacttcctgctggcggagagtgtggccatccttttatacctgagctacaagtac
cagatagacacacactggtacccacctcagctgcaagcctgcacccacatcagggagtac
cgggtatggcagcacaccgccatccagcagccttccaccaacgtttacctgtgcaagtct
ttcctgccccacttcttggggcagcctgtggatgccacacagctggtgcagctgttggga
aggctgatgtctgctctgcaacaccaggatccagaggccctggtggccaagcccttcctg
gtgactgagcaggtctccctggtggaaccgacggtgctcacggagcggatgcaggaggcc
cacaggcttgtacttcaaccttgggaaccccaagaggcccagcaggaaccccagctggcc
caggagctggtgccgcggctgcaggagcggctccactga

DBGET integrated database retrieval system