Pteropus alecto (black flying fox): 102882795 Help Entry 102882795         CDS       T02993                                  Name (RefSeq) glutathione S-transferase theta-4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis - DNA adducts pale05207   Chemical carcinogenesis - receptor activation pale05208   Chemical carcinogenesis - reactive oxygen species pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102882795   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102882795    00982 Drug metabolism - cytochrome P450     102882795    00983 Drug metabolism - other enzymes     102882795  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102882795    05204 Chemical carcinogenesis - DNA adducts     102882795    05207 Chemical carcinogenesis - receptor activation     102882795    05208 Chemical carcinogenesis - reactive oxygen species     102882795   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102882795   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102882795   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102882795  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102882795 Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102882795 Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102882795 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_C_7 GBD_Tenm3 Motif Other DBs NCBI-GeneID:  102882795 NCBI-ProteinID:  XP_015442372 UniProt:  L5KWN0 LinkDB All DBs Position Unknown AA seq 241 aa AA seqDB search MGLELYLDLLSASCRAVYIFARKNSIPFDFQFVDLLKGQHHSKEYTEINPLKKLPSLRDG KFVLSESAAILLYLCRKYSTPSHWYPPDLHMRARVDEFMAWQHTAIQMPMNKILWIKLLI PMITGEEVPAEKTEEMIAEANKNLQLFEEKFLQDRMFITGDHISLADLVALVQMMQPIGS NHDVFLNSSKLAEWRMRVELAIGSGLFWEAHDRLVKLVEWDCSTLDPMVKERICDLLHKF K NT seq 726 nt NT seq  +upstreamnt  +downstreamnt atgggcctggagctctacctggacctgctgtcagcatcctgccgcgccgtctacatcttc gccagaaagaacagcatccccttcgactttcagtttgtggatctgctgaaaggtcagcat cacagcaaggaatatactgagatcaatcccctgaagaagctgcccagcctcagagatgga aaattcgtcttatctgaaagcgcggccatcctcttgtacttgtgccgcaagtacagcacc ccctcgcactggtacccaccagacctgcacatgcgcgcccgtgtggatgagttcatggcc tggcagcacacggccattcaaatgcccatgaacaagatactttggatcaagctgctgatc ccgatgatcacaggtgaggaggttccagctgagaagacagaggagatgatagcagaggca aacaaaaacctgcagctcttcgaggagaagtttctgcaggacagaatgttcatcactggg gaccacatctcactggctgacttggtggccctggtgcagatgatgcagcccatagggagc aaccacgatgtcttcctcaacagctccaagctggcagagtggcgcatgagggtggagctg gccattggctctggcctcttctgggaggcccatgaccggctggtgaagttggtagagtgg gactgttcaacgttggatccaatggtcaaggagaggatctgtgacttgctacacaagttc aagtag

Pteropus alecto (black flying fox): 102883042 Help Entry 102883042         CDS       T02993                                  Name (RefSeq) glutathione S-transferase theta-1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis - DNA adducts pale05207   Chemical carcinogenesis - receptor activation pale05208   Chemical carcinogenesis - reactive oxygen species pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102883042   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102883042    00982 Drug metabolism - cytochrome P450     102883042    00983 Drug metabolism - other enzymes     102883042  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102883042    05204 Chemical carcinogenesis - DNA adducts     102883042    05207 Chemical carcinogenesis - receptor activation     102883042    05208 Chemical carcinogenesis - reactive oxygen species     102883042   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102883042   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102883042   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102883042  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102883042 Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102883042 Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102883042 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N GST_N_3 GST_N_2 GST_C GST_N_4 GST_C_3 GST_C_2 Motif Other DBs NCBI-GeneID:  102883042 NCBI-ProteinID:  XP_006908737 LinkDB All DBs Position Unknown AA seq 240 aa AA seqDB search MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSNAFAQVNPLKKVPALKDG DFILTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRNCLRALWHKAMF SVFLGEPVSPEMLAATLAELDVTLKILEDKFLQKNAFLSGPYISLADLVAITELMHVSTV GKVGPLGRPKLAAWRQRVEAAVGKILFQEAHETILNVKNFPPADPVIKQKLMPGILAMIQ NT seq 723 nt NT seq  +upstreamnt  +downstreamnt atgggcctggagctctacctggacctgctgtcccagccctgccgcgctgtctacatcttc gccaagaagaacggcatcccctttgagctgcgcaccgtggagctgctcaaaggccagcat ctcagcaatgcctttgcccaggtgaaccccttgaagaaagtgcctgccttgaaggatggg gacttcatcttgactgagagtgtggccatattgctctacctgacccgcaagtataaggtc cctgaccactggtaccctcaggacctgcaggcccgtgcccgtgtggatgagtacctggca tggcagcacacaaccctgcggagaaactgcctccgggccctgtggcataaggcgatgttc tctgttttcctgggtgagccagtatctcctgaaatgctggcagccacactagcagagttg gatgtgaccttgaagatacttgaggacaagttcctccagaagaatgcttttctgtccggg ccctacatttccctggctgacctggtagccatcacggagctgatgcatgtgagtactgtg ggcaaggtaggcccacttggcagacccaagctggctgcttggcgccagcgcgtggaagca gcagtgggaaagatcctcttccaagaggcccatgagaccatcctgaatgtcaagaacttt ccacctgcagaccccgtcataaagcagaagctgatgcctgggatactggccatgatccaa tga

Pteropus alecto (black flying fox): 102883292 Help Entry 102883292         CDS       T02993                                  Name (RefSeq) glutathione S-transferase theta-3   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis - DNA adducts pale05207   Chemical carcinogenesis - receptor activation pale05208   Chemical carcinogenesis - reactive oxygen species pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102883292   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102883292    00982 Drug metabolism - cytochrome P450     102883292    00983 Drug metabolism - other enzymes     102883292  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102883292    05204 Chemical carcinogenesis - DNA adducts     102883292    05207 Chemical carcinogenesis - receptor activation     102883292    05208 Chemical carcinogenesis - reactive oxygen species     102883292   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102883292   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102883292   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102883292  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102883292 Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102883292 Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102883292 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4 Motif Other DBs NCBI-GeneID:  102883292 NCBI-ProteinID:  XP_006908738 UniProt:  L5KW11 LinkDB All DBs Position Unknown AA seq 240 aa AA seqDB search MSLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQQHSNAFAQVNPLKKVPALKDG DFTLAESVAILLYLSRKYKAPDHWYPQDLQACARVDEYLAWQHTALRSSCTRAMWQKMLF PVFLGEQVPPEMLASTLAELDRCLQLLEDKFLKDQDFLAGPHISVADLVAITELMHPVSA GCQVFKSRPKLAAWHKRVEAAVGEDLFQEAHAAVMKAKDMPPADTATKERLKPLAQFLLK NT seq 723 nt NT seq  +upstreamnt  +downstreamnt atgagcctggagctctacctggacctcctgtcccagccctgccgcgccgtctacatattc gccaagaaaaacggcatccccttcgagctccgcaccgtggatctgctcaaaggccagcag cacagcaatgcctttgcccaggtgaaccccctgaagaaagtgccagccttgaaggatggg gactttaccttggctgagagtgtggccatcttgctgtatctgagccgcaagtacaaggcc cctgaccactggtacccccaggacctgcaggcctgcgcccgtgtggacgagtacttggcg tggcagcacacggccctgcggagtagctgcacccgagccatgtggcagaagatgctgttc cctgtgttcctgggtgaacaggtgccccctgaaatgttagcgtcgactctggctgagctg gacaggtgcctacagctgcttgaggacaagttcctgaaggaccaggatttccttgctggg cctcatatctcagtggctgacttggtagccatcacagagctgatgcatcctgtcagtgct ggctgccaagtcttcaaaagccgacccaagctggctgcctggcataagcgtgtggaggcc gcagtgggagaggacctcttccaggaggcccatgctgctgtcatgaaggccaaggacatg cctccagcggacactgccacaaaggagaggctgaagcccttggcgcagtttttattgaag tga

Pteropus alecto (black flying fox): 102885225 Help Entry 102885225         CDS       T02993                                  Symbol MGST2 Name (RefSeq) microsomal glutathione S-transferase 2   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis - DNA adducts pale05207   Chemical carcinogenesis - receptor activation pale05208   Chemical carcinogenesis - reactive oxygen species pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102885225 (MGST2)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102885225 (MGST2)    00982 Drug metabolism - cytochrome P450     102885225 (MGST2)    00983 Drug metabolism - other enzymes     102885225 (MGST2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102885225 (MGST2)    05204 Chemical carcinogenesis - DNA adducts     102885225 (MGST2)    05207 Chemical carcinogenesis - receptor activation     102885225 (MGST2)    05208 Chemical carcinogenesis - reactive oxygen species     102885225 (MGST2)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102885225 (MGST2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102885225 (MGST2)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102885225 (MGST2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102885225 (MGST2) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102885225 (MGST2) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102885225 (MGST2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MAPEG Motif Other DBs NCBI-GeneID:  102885225 NCBI-ProteinID:  XP_006906283 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MPPAVSGSPEFERIFRAQQNCVEFYPVFLITLWMAGWYFHQVFATCLGLVYIYERYQYFW GYSEDANKRLTGFRLSLGILALLAVLGSLGIANSFLDEYLHLNIAKKLRHF NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgcctccagcagtctctgggtcaccagagtttgagagaatatttcgtgcacaacaaaac tgtgtggaattttaccccgtattcctgattacattgtggatggctggttggtatttccac caagtttttgctacctgtctgggtctggtgtatatatatgaacgttaccagtatttctgg ggatattcagaagatgctaacaaaagattgactggtttccggttgagtctggggattttg gccttgctggctgtcctaggctccctggggattgcaaacagctttctggatgaatacctg cacctcaatattgccaagaagctgaggcacttctag

Pteropus alecto (black flying fox): 102886852 Help Entry 102886852         CDS       T02993                                  Symbol GSTO2 Name (RefSeq) glutathione S-transferase omega-2   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis - DNA adducts pale05207   Chemical carcinogenesis - receptor activation pale05208   Chemical carcinogenesis - reactive oxygen species pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102886852 (GSTO2)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102886852 (GSTO2)    00982 Drug metabolism - cytochrome P450     102886852 (GSTO2)    00983 Drug metabolism - other enzymes     102886852 (GSTO2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102886852 (GSTO2)    05204 Chemical carcinogenesis - DNA adducts     102886852 (GSTO2)    05207 Chemical carcinogenesis - receptor activation     102886852 (GSTO2)    05208 Chemical carcinogenesis - reactive oxygen species     102886852 (GSTO2)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102886852 (GSTO2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102886852 (GSTO2)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102886852 (GSTO2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102886852 (GSTO2) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102886852 (GSTO2) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102886852 (GSTO2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N_2 GST_N_3 GST_N GST_C_2 GST_C_3 Glutaredoxin CLIC-like_N Motif Other DBs NCBI-GeneID:  102886852 NCBI-ProteinID:  XP_006920943 LinkDB All DBs Position Unknown AA seq 244 aa AA seqDB search MSDDASRSLGKGSIPPGPVPEGLIRVYSNRFCPYAHRTRLVLQAKGIRHEVININLRNKP EWYYSKHPFGQIPVLENSRCQLIYESVIACEYLDDAYPGRKLYPFDPYERARQKMLLELF YKVPHLTKECLVALRYGRECADLKLALRQEFCNLEEILDYQNTVFFGGDCISMIDYLFWP WFERLDVYGIADCVNHTPALRLWISAMKQDPAVCSLIIDKNIFLGFLNLYFQNHPDAFDY GLSC NT seq 735 nt NT seq  +upstreamnt  +downstreamnt atgagtgatgatgcgagcaggtccttggggaaaggaagcatccccccagggccggtccca gagggcctgatccgcgtctacagcaataggttctgcccttacgcacaccggacacgcctt gtcctccaggccaaaggcatcagacatgaagttatcaacattaatctgagaaacaagcct gaatggtactattcaaagcacccttttggccaaattcctgtcttggaaaacagcagatgt caactgatctatgaatctgtcatcgcttgtgagtacctggatgatgcttatcctggaagg aagctgtatccatttgacccttatgagcgggctcgacaaaagatgttattggagctattc tataaggtcccacatttgaccaaggagtgtctggtagcattgagatacgggagagaatgt gctgatctgaagctagcccttcgtcaggaattctgcaaccttgaagagattcttgactat cagaacaccgtcttctttggtggagactgtatatccatgatcgattacctcttttggccc tggtttgagcggctggatgtatacggaatagctgactgtgtgaaccacaccccggcactt cggctctggatatcagccatgaagcaggaccctgcagtgtgttctcttatcatcgataag aacatttttctgggtttcttgaatctctattttcagaaccaccctgatgcctttgactat gggctgagttgctga

Pteropus alecto (black flying fox): 102887110 Help Entry 102887110         CDS       T02993                                  Symbol GSTO1 Name (RefSeq) glutathione S-transferase omega-1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis - DNA adducts pale05207   Chemical carcinogenesis - receptor activation pale05208   Chemical carcinogenesis - reactive oxygen species pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102887110 (GSTO1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102887110 (GSTO1)    00982 Drug metabolism - cytochrome P450     102887110 (GSTO1)    00983 Drug metabolism - other enzymes     102887110 (GSTO1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102887110 (GSTO1)    05204 Chemical carcinogenesis - DNA adducts     102887110 (GSTO1)    05207 Chemical carcinogenesis - receptor activation     102887110 (GSTO1)    05208 Chemical carcinogenesis - reactive oxygen species     102887110 (GSTO1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102887110 (GSTO1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102887110 (GSTO1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102887110 (GSTO1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102887110 (GSTO1) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102887110 (GSTO1) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102887110 (GSTO1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N_3 GST_N_2 GST_N GST_C_3 GST_C CLIC-like_N Glutaredoxin GST_C_2 GST_N_4 YxiF GST_C_5 Zona_CL2 Motif Other DBs NCBI-GeneID:  102887110 NCBI-ProteinID:  XP_006920944 UniProt:  L5K2K3 LinkDB All DBs Position Unknown AA seq 241 aa AA seqDB search MSGASARSLEKGSAPPGPVPEGLIRLYSMRFCPYAQRTRLVLKAKGIRHEIININLKNKP EWFFKKNPFGLVPVLENSKGQLVCDSAIICEYLDEAYPGKKLLPEDPYEKACQKMSFELF SKVPSLEGSYIRNKNKEDCSGIKEELRKEFSKLEEVLTNKKTTFFGGNSLSMIDYLIWPW FECLEALELSECVDHTPKLKLWMAAMREDPTVSALLTDVKTFRGCLDLYLQNSVEACDYG L NT seq 726 nt NT seq  +upstreamnt  +downstreamnt atgtccggagcatcagccaggagcctggagaaagggagtgcgcccccaggaccggtcccg gagggcctgatccgcctctatagcatgaggttctgcccctacgcccagaggacgcgcctt gtcctgaaggccaagggaatccggcatgaaatcatcaacattaacctgaaaaataagcct gagtggttctttaagaagaatccctttggtctggtgccagttctggaaaacagtaagggt caactggtctgtgactctgccatcatttgtgagtacctggatgaagcatatccagggaag aagctgttgccagaagacccttatgagaaagcatgccaaaagatgtcctttgagttattt tcaaaggtaccatctttggaaggaagctatattagaaataaaaataaggaagactgctct ggcataaaagaagaacttcgcaaagaattcagcaagcttgaggaggttctgaccaataag aaaacaaccttctttggtggcaattcactttccatgattgattacctcatctggccctgg tttgaatgtctggaagcactggagttaagcgagtgtgtagaccacactccaaaacttaag ctctggatggcagccatgagggaagatcccacagtatcagccctcctcactgatgtgaag acctttcgaggttgcttagatctctacttgcagaatagcgtagaggcctgtgactacggg ctctga

Pteropus alecto (black flying fox): 102887332 Help Entry 102887332         CDS       T02993                                  Symbol MGST1 Name (RefSeq) microsomal glutathione S-transferase 1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis - DNA adducts pale05207   Chemical carcinogenesis - receptor activation pale05208   Chemical carcinogenesis - reactive oxygen species pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102887332 (MGST1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102887332 (MGST1)    00982 Drug metabolism - cytochrome P450     102887332 (MGST1)    00983 Drug metabolism - other enzymes     102887332 (MGST1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102887332 (MGST1)    05204 Chemical carcinogenesis - DNA adducts     102887332 (MGST1)    05207 Chemical carcinogenesis - receptor activation     102887332 (MGST1)    05208 Chemical carcinogenesis - reactive oxygen species     102887332 (MGST1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102887332 (MGST1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102887332 (MGST1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102887332 (MGST1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102887332 (MGST1) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102887332 (MGST1) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102887332 (MGST1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MAPEG Motif Other DBs NCBI-GeneID:  102887332 NCBI-ProteinID:  XP_006912721 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MVDLTQLMENEVFMSFASYTTIILSKMMFMSIVTAFYRLTRKVFTNPEDSVVFGGKGENA KKYLRTDDNVERVRRAHLNDLENIVPFFGIGLLYSLSDPDLSTAILHFRLFLGARIYHTV AYLLPLPQPNRAFSFFVGYGVTLSMAYRLLKSRLYL NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggttgatctcacccagctaatggaaaatgaagtattcatgtcctttgcctcctataca acgattatactttcaaaaatgatgtttatgagcattgtaactgcattctacagattgaca agaaaggtttttaccaacccagaagactctgtagtctttgggggaaaaggagaaaatgcc aagaagtatcttcggacagatgacaacgtggaacgtgtacgaagggcgcacctgaatgac cttgaaaatatcgtgccattttttggtatcggcctcctatattccttgagtgatccagat ctctctacagccatcctgcacttcaggctctttcttggagcacggatctatcatacagtt gcatatttgttacctcttccccagccaaatcgtgctttttctttttttgttggatatgga gttactctttcgatggcttacagattgctgaagagcagattgtacctgtaa

Pteropus alecto (black flying fox): 102889068 Help Entry 102889068         CDS       T02993                                  Name (RefSeq) glutathione S-transferase P isoform X2   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis - DNA adducts pale05215   Prostate cancer pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102889068   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102889068    00982 Drug metabolism - cytochrome P450     102889068    00983 Drug metabolism - other enzymes     102889068  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102889068    05204 Chemical carcinogenesis - DNA adducts     102889068   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102889068    05215 Prostate cancer     102889068   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102889068   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102889068  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102889068 Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102889068 Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102889068 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  102889068 NCBI-ProteinID:  XP_006911075 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MRMLLADQGQSWKEEVVTKETWLQGPLKASCLFGQLPKLQDGDLTLYQSNAILRHLGRSF GLYGKDQREAALVDMVNDGVADLRNLCGHLIHHDCEEDKARYMRDLPEHLKPFETLLAQN QGGQAFIVGNQISFADYNLLDLLLTHQVLTPGCLDAFPLLSAYVARLSARPKLKAFLASP EHVNRPVFGSRKT NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgcgcatgctgctggctgaccagggccagagctggaaagaggaggtggtgaccaaggag acctggctgcagggccctctcaaggcctcctgtctgttcgggcagctccccaagctccag gatggagacctcactctgtaccagtccaatgccatcctccgccacctgggccgctccttc gggctctacggcaaagaccagcgggaggcggcgctggtggacatggtgaacgacggtgtg gcggacctccgcaacctctgcggccacctcatccaccacgactgtgaggaggacaaggcc cggtacatgcgggacctgccagagcacctgaagccttttgagacgctgctggcccagaac caggggggccaggccttcattgtgggcaaccagatctccttcgccgactacaacctgctc gacttgctgctgacccaccaggtcctgacccccggctgcctggacgccttccccttgctc tcggcctacgtggcccgcctcagtgcccggcccaagctcaaggccttcctggcctcccct gagcacgtgaaccgccctgtctttggaagccgcaagacatga

Pteropus alecto (black flying fox): 102891202 Help Entry 102891202         CDS       T02993                                  Symbol MGST3 Name (RefSeq) microsomal glutathione S-transferase 3   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis - DNA adducts pale05207   Chemical carcinogenesis - receptor activation pale05208   Chemical carcinogenesis - reactive oxygen species pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102891202 (MGST3)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102891202 (MGST3)    00982 Drug metabolism - cytochrome P450     102891202 (MGST3)    00983 Drug metabolism - other enzymes     102891202 (MGST3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102891202 (MGST3)    05204 Chemical carcinogenesis - DNA adducts     102891202 (MGST3)    05207 Chemical carcinogenesis - receptor activation     102891202 (MGST3)    05208 Chemical carcinogenesis - reactive oxygen species     102891202 (MGST3)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102891202 (MGST3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102891202 (MGST3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102891202 (MGST3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102891202 (MGST3) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102891202 (MGST3) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102891202 (MGST3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MAPEG Motif Other DBs NCBI-GeneID:  102891202 NCBI-ProteinID:  XP_006907897 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MAVLSKEYGFVVLTGAASFIMVGHLAFNVSKARKKYKVEYPTMYSADPENGHLFNCIQRA HQNTLEAYPAFLFFLAVGGVYHPRVASGLGLAWIVGRVLYAYGYYTGDPSKRSRGALGSV ALLGLLGTTVVSAFQHLGWLRPGLGSECKSCH NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggccgtcctctccaaggagtatggcttcgtggtgctgacgggggccgccagcttcatc atggtcggccatctggccttcaatgtgtccaaggcccgcaagaagtacaaggtggagtac cccaccatgtacagcgcagaccccgagaacggacacctgttcaactgcattcagcgagcc caccagaacacgttggaagcgtatccggccttcttgttttttctagctgttgggggtgtt taccacccgcgagtagcttccggtttgggcctggcctggattgtcggacgggttctctac gcctacggctattacacaggagaccctagcaagcggagccggggggcgctgggctccgtc gcccttctcggcttactgggcaccaccgtggtctcggccttccagcacctcggctggctt agacctggcttgggcagtgagtgcaaatcctgccattaa

Pteropus alecto (black flying fox): 102891351 Help Entry 102891351         CDS       T02993                                  Symbol GSTA4 Name (RefSeq) glutathione S-transferase A4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis - DNA adducts pale05207   Chemical carcinogenesis - receptor activation pale05208   Chemical carcinogenesis - reactive oxygen species pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102891351 (GSTA4)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102891351 (GSTA4)    00982 Drug metabolism - cytochrome P450     102891351 (GSTA4)    00983 Drug metabolism - other enzymes     102891351 (GSTA4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102891351 (GSTA4)    05204 Chemical carcinogenesis - DNA adducts     102891351 (GSTA4)    05207 Chemical carcinogenesis - receptor activation     102891351 (GSTA4)    05208 Chemical carcinogenesis - reactive oxygen species     102891351 (GSTA4)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102891351 (GSTA4)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102891351 (GSTA4)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102891351 (GSTA4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102891351 (GSTA4) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102891351 (GSTA4) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102891351 (GSTA4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  102891351 NCBI-ProteinID:  XP_006926883 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MAEKPKLHYPNGRGRMETVRWVLAAAGVEFDEEFLETKEQLQKLQDGNHLLFQQVPMVEI DGMKLVQTRSILHYIADRHHLFGKDLKERTLIDMYVEGTLDLLELIIMHPFLKPDDQQKE VVNMAQKAIIRYFPVFEKVLREHGQRFLVGNQLSLADIILLQTILALEEKIPNILSSFPH LQEYTVKMSNIPTIKKFLEPGSKKKPPPDEIYVRTVYN NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atggcagagaagcccaagctccactatccaaatggaagaggtcggatggaaaccgtaaga tgggttttagctgccgctggagtggagtttgatgaagaatttttagaaacaaaagaacag ttgcagaagttgcaggatggtaaccacctgctgttccaacaagtgccaatggttgaaatt gacgggatgaagttggtgcagacccgaagcattctccactacatagcggacaggcaccat ctctttggcaaggacctcaaggagagaaccctgattgacatgtatgtggaggggacgctg gatctgctggaactgattatcatgcatcctttcctaaaaccagacgatcaacagaaggaa gtggttaacatggctcagaaggctataattagatactttcctgtgtttgaaaaggttcta agggaacatggacaaaggtttcttgttggtaatcagctgagccttgcagatataattcta ctccaaaccattttggctctagaggagaaaattcctaatatcctgtcatcatttcctcac ctccaggagtacacagtgaaaatgagtaatattcccacaattaagaaattccttgaacct ggcagcaagaagaagcctcctccagatgaaatctatgtgagaaccgtttacaac

DBGET integrated database retrieval system