Pteropus alecto (black flying fox): 102882795 Help Entry 102882795         CDS       T02993                                  Definition (RefSeq) glutathione S-transferase theta-4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102882795   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102882795    00982 Drug metabolism - cytochrome P450     102882795    00983 Drug metabolism - other enzymes     102882795  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102882795    05204 Chemical carcinogenesis     102882795   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102882795   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102882795   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102882795  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102882795 Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102882795 Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102882795 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Motif Other DBs NCBI-GeneID:  102882795 NCBI-ProteinID:  XP_015442372 UniProt:  L5KWN0 LinkDB All DBs Position Unknown AA seq 241 aa AA seqDB search MGLELYLDLLSASCRAVYIFARKNSIPFDFQFVDLLKGQHHSKEYTEINPLKKLPSLRDG KFVLSESAAILLYLCRKYSTPSHWYPPDLHMRARVDEFMAWQHTAIQMPMNKILWIKLLI PMITGEEVPAEKTEEMIAEANKNLQLFEEKFLQDRMFITGDHISLADLVALVQMMQPIGS NHDVFLNSSKLAEWRMRVELAIGSGLFWEAHDRLVKLVEWDCSTLDPMVKERICDLLHKF K NT seq 726 nt NT seq  +upstreamnt  +downstreamnt atgggcctggagctctacctggacctgctgtcagcatcctgccgcgccgtctacatcttc gccagaaagaacagcatccccttcgactttcagtttgtggatctgctgaaaggtcagcat cacagcaaggaatatactgagatcaatcccctgaagaagctgcccagcctcagagatgga aaattcgtcttatctgaaagcgcggccatcctcttgtacttgtgccgcaagtacagcacc ccctcgcactggtacccaccagacctgcacatgcgcgcccgtgtggatgagttcatggcc tggcagcacacggccattcaaatgcccatgaacaagatactttggatcaagctgctgatc ccgatgatcacaggtgaggaggttccagctgagaagacagaggagatgatagcagaggca aacaaaaacctgcagctcttcgaggagaagtttctgcaggacagaatgttcatcactggg gaccacatctcactggctgacttggtggccctggtgcagatgatgcagcccatagggagc aaccacgatgtcttcctcaacagctccaagctggcagagtggcgcatgagggtggagctg gccattggctctggcctcttctgggaggcccatgaccggctggtgaagttggtagagtgg gactgttcaacgttggatccaatggtcaaggagaggatctgtgacttgctacacaagttc aagtag

Pteropus alecto (black flying fox): 102883042 Help Entry 102883042         CDS       T02993                                  Definition (RefSeq) glutathione S-transferase theta-1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102883042   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102883042    00982 Drug metabolism - cytochrome P450     102883042    00983 Drug metabolism - other enzymes     102883042  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102883042    05204 Chemical carcinogenesis     102883042   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102883042   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102883042   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102883042  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102883042 Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102883042 Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102883042 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_N_4 GST_C_2 Motif Other DBs NCBI-GeneID:  102883042 NCBI-ProteinID:  XP_006908737 LinkDB All DBs Position Unknown AA seq 240 aa AA seqDB search MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSNAFAQVNPLKKVPALKDG DFILTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRNCLRALWHKAMF SVFLGEPVSPEMLAATLAELDVTLKILEDKFLQKNAFLSGPYISLADLVAITELMHVSTV GKVGPLGRPKLAAWRQRVEAAVGKILFQEAHETILNVKNFPPADPVIKQKLMPGILAMIQ NT seq 723 nt NT seq  +upstreamnt  +downstreamnt atgggcctggagctctacctggacctgctgtcccagccctgccgcgctgtctacatcttc gccaagaagaacggcatcccctttgagctgcgcaccgtggagctgctcaaaggccagcat ctcagcaatgcctttgcccaggtgaaccccttgaagaaagtgcctgccttgaaggatggg gacttcatcttgactgagagtgtggccatattgctctacctgacccgcaagtataaggtc cctgaccactggtaccctcaggacctgcaggcccgtgcccgtgtggatgagtacctggca tggcagcacacaaccctgcggagaaactgcctccgggccctgtggcataaggcgatgttc tctgttttcctgggtgagccagtatctcctgaaatgctggcagccacactagcagagttg gatgtgaccttgaagatacttgaggacaagttcctccagaagaatgcttttctgtccggg ccctacatttccctggctgacctggtagccatcacggagctgatgcatgtgagtactgtg ggcaaggtaggcccacttggcagacccaagctggctgcttggcgccagcgcgtggaagca gcagtgggaaagatcctcttccaagaggcccatgagaccatcctgaatgtcaagaacttt ccacctgcagaccccgtcataaagcagaagctgatgcctgggatactggccatgatccaa tga

Pteropus alecto (black flying fox): 102883292 Help Entry 102883292         CDS       T02993                                  Definition (RefSeq) glutathione S-transferase theta-3   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102883292   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102883292    00982 Drug metabolism - cytochrome P450     102883292    00983 Drug metabolism - other enzymes     102883292  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102883292    05204 Chemical carcinogenesis     102883292   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102883292   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102883292   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102883292  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102883292 Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102883292 Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102883292 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 GST_N_4 Motif Other DBs NCBI-GeneID:  102883292 NCBI-ProteinID:  XP_006908738 UniProt:  L5KW11 LinkDB All DBs Position Unknown AA seq 240 aa AA seqDB search MSLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQQHSNAFAQVNPLKKVPALKDG DFTLAESVAILLYLSRKYKAPDHWYPQDLQACARVDEYLAWQHTALRSSCTRAMWQKMLF PVFLGEQVPPEMLASTLAELDRCLQLLEDKFLKDQDFLAGPHISVADLVAITELMHPVSA GCQVFKSRPKLAAWHKRVEAAVGEDLFQEAHAAVMKAKDMPPADTATKERLKPLAQFLLK NT seq 723 nt NT seq  +upstreamnt  +downstreamnt atgagcctggagctctacctggacctcctgtcccagccctgccgcgccgtctacatattc gccaagaaaaacggcatccccttcgagctccgcaccgtggatctgctcaaaggccagcag cacagcaatgcctttgcccaggtgaaccccctgaagaaagtgccagccttgaaggatggg gactttaccttggctgagagtgtggccatcttgctgtatctgagccgcaagtacaaggcc cctgaccactggtacccccaggacctgcaggcctgcgcccgtgtggacgagtacttggcg tggcagcacacggccctgcggagtagctgcacccgagccatgtggcagaagatgctgttc cctgtgttcctgggtgaacaggtgccccctgaaatgttagcgtcgactctggctgagctg gacaggtgcctacagctgcttgaggacaagttcctgaaggaccaggatttccttgctggg cctcatatctcagtggctgacttggtagccatcacagagctgatgcatcctgtcagtgct ggctgccaagtcttcaaaagccgacccaagctggctgcctggcataagcgtgtggaggcc gcagtgggagaggacctcttccaggaggcccatgctgctgtcatgaaggccaaggacatg cctccagcggacactgccacaaaggagaggctgaagcccttggcgcagtttttattgaag tga

Pteropus alecto (black flying fox): 102885225 Help Entry 102885225         CDS       T02993                                  Gene name MGST2 Definition (RefSeq) microsomal glutathione S-transferase 2   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102885225 (MGST2)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102885225 (MGST2)    00982 Drug metabolism - cytochrome P450     102885225 (MGST2)    00983 Drug metabolism - other enzymes     102885225 (MGST2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102885225 (MGST2)    05204 Chemical carcinogenesis     102885225 (MGST2)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102885225 (MGST2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102885225 (MGST2)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102885225 (MGST2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102885225 (MGST2) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102885225 (MGST2) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102885225 (MGST2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MAPEG Motif Other DBs NCBI-GeneID:  102885225 NCBI-ProteinID:  XP_006906283 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MPPAVSGSPEFERIFRAQQNCVEFYPVFLITLWMAGWYFHQVFATCLGLVYIYERYQYFW GYSEDANKRLTGFRLSLGILALLAVLGSLGIANSFLDEYLHLNIAKKLRHF NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgcctccagcagtctctgggtcaccagagtttgagagaatatttcgtgcacaacaaaac tgtgtggaattttaccccgtattcctgattacattgtggatggctggttggtatttccac caagtttttgctacctgtctgggtctggtgtatatatatgaacgttaccagtatttctgg ggatattcagaagatgctaacaaaagattgactggtttccggttgagtctggggattttg gccttgctggctgtcctaggctccctggggattgcaaacagctttctggatgaatacctg cacctcaatattgccaagaagctgaggcacttctag

Pteropus alecto (black flying fox): 102886852 Help Entry 102886852         CDS       T02993                                  Gene name GSTO2 Definition (RefSeq) glutathione S-transferase omega-2   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102886852 (GSTO2)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102886852 (GSTO2)    00982 Drug metabolism - cytochrome P450     102886852 (GSTO2)    00983 Drug metabolism - other enzymes     102886852 (GSTO2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102886852 (GSTO2)    05204 Chemical carcinogenesis     102886852 (GSTO2)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102886852 (GSTO2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102886852 (GSTO2)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102886852 (GSTO2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102886852 (GSTO2) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102886852 (GSTO2) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102886852 (GSTO2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C Motif Other DBs NCBI-GeneID:  102886852 NCBI-ProteinID:  XP_006920943 LinkDB All DBs Position Unknown AA seq 244 aa AA seqDB search MSDDASRSLGKGSIPPGPVPEGLIRVYSNRFCPYAHRTRLVLQAKGIRHEVININLRNKP EWYYSKHPFGQIPVLENSRCQLIYESVIACEYLDDAYPGRKLYPFDPYERARQKMLLELF YKVPHLTKECLVALRYGRECADLKLALRQEFCNLEEILDYQNTVFFGGDCISMIDYLFWP WFERLDVYGIADCVNHTPALRLWISAMKQDPAVCSLIIDKNIFLGFLNLYFQNHPDAFDY GLSC NT seq 735 nt NT seq  +upstreamnt  +downstreamnt atgagtgatgatgcgagcaggtccttggggaaaggaagcatccccccagggccggtccca gagggcctgatccgcgtctacagcaataggttctgcccttacgcacaccggacacgcctt gtcctccaggccaaaggcatcagacatgaagttatcaacattaatctgagaaacaagcct gaatggtactattcaaagcacccttttggccaaattcctgtcttggaaaacagcagatgt caactgatctatgaatctgtcatcgcttgtgagtacctggatgatgcttatcctggaagg aagctgtatccatttgacccttatgagcgggctcgacaaaagatgttattggagctattc tataaggtcccacatttgaccaaggagtgtctggtagcattgagatacgggagagaatgt gctgatctgaagctagcccttcgtcaggaattctgcaaccttgaagagattcttgactat cagaacaccgtcttctttggtggagactgtatatccatgatcgattacctcttttggccc tggtttgagcggctggatgtatacggaatagctgactgtgtgaaccacaccccggcactt cggctctggatatcagccatgaagcaggaccctgcagtgtgttctcttatcatcgataag aacatttttctgggtttcttgaatctctattttcagaaccaccctgatgcctttgactat gggctgagttgctga

Pteropus alecto (black flying fox): 102887110 Help Entry 102887110         CDS       T02993                                  Gene name GSTO1 Definition (RefSeq) glutathione S-transferase omega-1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102887110 (GSTO1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102887110 (GSTO1)    00982 Drug metabolism - cytochrome P450     102887110 (GSTO1)    00983 Drug metabolism - other enzymes     102887110 (GSTO1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102887110 (GSTO1)    05204 Chemical carcinogenesis     102887110 (GSTO1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102887110 (GSTO1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102887110 (GSTO1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102887110 (GSTO1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102887110 (GSTO1) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102887110 (GSTO1) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102887110 (GSTO1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin GST_N_4 GST_C_5 Motif Other DBs NCBI-GeneID:  102887110 NCBI-ProteinID:  XP_006920944 UniProt:  L5K2K3 LinkDB All DBs Position Unknown AA seq 241 aa AA seqDB search MSGASARSLEKGSAPPGPVPEGLIRLYSMRFCPYAQRTRLVLKAKGIRHEIININLKNKP EWFFKKNPFGLVPVLENSKGQLVCDSAIICEYLDEAYPGKKLLPEDPYEKACQKMSFELF SKVPSLEGSYIRNKNKEDCSGIKEELRKEFSKLEEVLTNKKTTFFGGNSLSMIDYLIWPW FECLEALELSECVDHTPKLKLWMAAMREDPTVSALLTDVKTFRGCLDLYLQNSVEACDYG L NT seq 726 nt NT seq  +upstreamnt  +downstreamnt atgtccggagcatcagccaggagcctggagaaagggagtgcgcccccaggaccggtcccg gagggcctgatccgcctctatagcatgaggttctgcccctacgcccagaggacgcgcctt gtcctgaaggccaagggaatccggcatgaaatcatcaacattaacctgaaaaataagcct gagtggttctttaagaagaatccctttggtctggtgccagttctggaaaacagtaagggt caactggtctgtgactctgccatcatttgtgagtacctggatgaagcatatccagggaag aagctgttgccagaagacccttatgagaaagcatgccaaaagatgtcctttgagttattt tcaaaggtaccatctttggaaggaagctatattagaaataaaaataaggaagactgctct ggcataaaagaagaacttcgcaaagaattcagcaagcttgaggaggttctgaccaataag aaaacaaccttctttggtggcaattcactttccatgattgattacctcatctggccctgg tttgaatgtctggaagcactggagttaagcgagtgtgtagaccacactccaaaacttaag ctctggatggcagccatgagggaagatcccacagtatcagccctcctcactgatgtgaag acctttcgaggttgcttagatctctacttgcagaatagcgtagaggcctgtgactacggg ctctga

Pteropus alecto (black flying fox): 102887332 Help Entry 102887332         CDS       T02993                                  Gene name MGST1 Definition (RefSeq) microsomal glutathione S-transferase 1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102887332 (MGST1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102887332 (MGST1)    00982 Drug metabolism - cytochrome P450     102887332 (MGST1)    00983 Drug metabolism - other enzymes     102887332 (MGST1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102887332 (MGST1)    05204 Chemical carcinogenesis     102887332 (MGST1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102887332 (MGST1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102887332 (MGST1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102887332 (MGST1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102887332 (MGST1) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102887332 (MGST1) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102887332 (MGST1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MAPEG Motif Other DBs NCBI-GeneID:  102887332 NCBI-ProteinID:  XP_006912721 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MVDLTQLMENEVFMSFASYTTIILSKMMFMSIVTAFYRLTRKVFTNPEDSVVFGGKGENA KKYLRTDDNVERVRRAHLNDLENIVPFFGIGLLYSLSDPDLSTAILHFRLFLGARIYHTV AYLLPLPQPNRAFSFFVGYGVTLSMAYRLLKSRLYL NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggttgatctcacccagctaatggaaaatgaagtattcatgtcctttgcctcctataca acgattatactttcaaaaatgatgtttatgagcattgtaactgcattctacagattgaca agaaaggtttttaccaacccagaagactctgtagtctttgggggaaaaggagaaaatgcc aagaagtatcttcggacagatgacaacgtggaacgtgtacgaagggcgcacctgaatgac cttgaaaatatcgtgccattttttggtatcggcctcctatattccttgagtgatccagat ctctctacagccatcctgcacttcaggctctttcttggagcacggatctatcatacagtt gcatatttgttacctcttccccagccaaatcgtgctttttctttttttgttggatatgga gttactctttcgatggcttacagattgctgaagagcagattgtacctgtaa

Pteropus alecto (black flying fox): 102889068 Help Entry 102889068         CDS       T02993                                  Definition (RefSeq) glutathione S-transferase P isoform X2   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05215   Prostate cancer pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102889068   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102889068    00982 Drug metabolism - cytochrome P450     102889068    00983 Drug metabolism - other enzymes     102889068  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102889068    05204 Chemical carcinogenesis     102889068   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102889068    05215 Prostate cancer     102889068   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102889068   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102889068  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102889068 Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102889068 Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102889068 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 GST_N_3 Motif Other DBs NCBI-GeneID:  102889068 NCBI-ProteinID:  XP_006911075 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MRMLLADQGQSWKEEVVTKETWLQGPLKASCLFGQLPKLQDGDLTLYQSNAILRHLGRSF GLYGKDQREAALVDMVNDGVADLRNLCGHLIHHDCEEDKARYMRDLPEHLKPFETLLAQN QGGQAFIVGNQISFADYNLLDLLLTHQVLTPGCLDAFPLLSAYVARLSARPKLKAFLASP EHVNRPVFGSRKT NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgcgcatgctgctggctgaccagggccagagctggaaagaggaggtggtgaccaaggag acctggctgcagggccctctcaaggcctcctgtctgttcgggcagctccccaagctccag gatggagacctcactctgtaccagtccaatgccatcctccgccacctgggccgctccttc gggctctacggcaaagaccagcgggaggcggcgctggtggacatggtgaacgacggtgtg gcggacctccgcaacctctgcggccacctcatccaccacgactgtgaggaggacaaggcc cggtacatgcgggacctgccagagcacctgaagccttttgagacgctgctggcccagaac caggggggccaggccttcattgtgggcaaccagatctccttcgccgactacaacctgctc gacttgctgctgacccaccaggtcctgacccccggctgcctggacgccttccccttgctc tcggcctacgtggcccgcctcagtgcccggcccaagctcaaggccttcctggcctcccct gagcacgtgaaccgccctgtctttggaagccgcaagacatga

Pteropus alecto (black flying fox): 102891202 Help Entry 102891202         CDS       T02993                                  Gene name MGST3 Definition (RefSeq) microsomal glutathione S-transferase 3   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102891202 (MGST3)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102891202 (MGST3)    00982 Drug metabolism - cytochrome P450     102891202 (MGST3)    00983 Drug metabolism - other enzymes     102891202 (MGST3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102891202 (MGST3)    05204 Chemical carcinogenesis     102891202 (MGST3)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102891202 (MGST3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102891202 (MGST3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102891202 (MGST3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102891202 (MGST3) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102891202 (MGST3) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102891202 (MGST3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MAPEG Motif Other DBs NCBI-GeneID:  102891202 NCBI-ProteinID:  XP_006907897 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MAVLSKEYGFVVLTGAASFIMVGHLAFNVSKARKKYKVEYPTMYSADPENGHLFNCIQRA HQNTLEAYPAFLFFLAVGGVYHPRVASGLGLAWIVGRVLYAYGYYTGDPSKRSRGALGSV ALLGLLGTTVVSAFQHLGWLRPGLGSECKSCH NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggccgtcctctccaaggagtatggcttcgtggtgctgacgggggccgccagcttcatc atggtcggccatctggccttcaatgtgtccaaggcccgcaagaagtacaaggtggagtac cccaccatgtacagcgcagaccccgagaacggacacctgttcaactgcattcagcgagcc caccagaacacgttggaagcgtatccggccttcttgttttttctagctgttgggggtgtt taccacccgcgagtagcttccggtttgggcctggcctggattgtcggacgggttctctac gcctacggctattacacaggagaccctagcaagcggagccggggggcgctgggctccgtc gcccttctcggcttactgggcaccaccgtggtctcggccttccagcacctcggctggctt agacctggcttgggcagtgagtgcaaatcctgccattaa

Pteropus alecto (black flying fox): 102891351 Help Entry 102891351         CDS       T02993                                  Gene name GSTA4 Definition (RefSeq) glutathione S-transferase A4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102891351 (GSTA4)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102891351 (GSTA4)    00982 Drug metabolism - cytochrome P450     102891351 (GSTA4)    00983 Drug metabolism - other enzymes     102891351 (GSTA4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102891351 (GSTA4)    05204 Chemical carcinogenesis     102891351 (GSTA4)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102891351 (GSTA4)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102891351 (GSTA4)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102891351 (GSTA4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102891351 (GSTA4) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102891351 (GSTA4) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102891351 (GSTA4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_N GST_C GST_C_2 GST_N_3 CbeA_antitoxin Motif Other DBs NCBI-GeneID:  102891351 NCBI-ProteinID:  XP_006926883 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MAEKPKLHYPNGRGRMETVRWVLAAAGVEFDEEFLETKEQLQKLQDGNHLLFQQVPMVEI DGMKLVQTRSILHYIADRHHLFGKDLKERTLIDMYVEGTLDLLELIIMHPFLKPDDQQKE VVNMAQKAIIRYFPVFEKVLREHGQRFLVGNQLSLADIILLQTILALEEKIPNILSSFPH LQEYTVKMSNIPTIKKFLEPGSKKKPPPDEIYVRTVYN NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atggcagagaagcccaagctccactatccaaatggaagaggtcggatggaaaccgtaaga tgggttttagctgccgctggagtggagtttgatgaagaatttttagaaacaaaagaacag ttgcagaagttgcaggatggtaaccacctgctgttccaacaagtgccaatggttgaaatt gacgggatgaagttggtgcagacccgaagcattctccactacatagcggacaggcaccat ctctttggcaaggacctcaaggagagaaccctgattgacatgtatgtggaggggacgctg gatctgctggaactgattatcatgcatcctttcctaaaaccagacgatcaacagaaggaa gtggttaacatggctcagaaggctataattagatactttcctgtgtttgaaaaggttcta agggaacatggacaaaggtttcttgttggtaatcagctgagccttgcagatataattcta ctccaaaccattttggctctagaggagaaaattcctaatatcctgtcatcatttcctcac ctccaggagtacacagtgaaaatgagtaatattcccacaattaagaaattccttgaacct ggcagcaagaagaagcctcctccagatgaaatctatgtgagaaccgtttacaac

Pteropus alecto (black flying fox): 102891589 Help Entry 102891589         CDS       T02993                                  Definition (RefSeq) glutathione S-transferase A4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102891589   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102891589    00982 Drug metabolism - cytochrome P450     102891589    00983 Drug metabolism - other enzymes     102891589  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102891589    05204 Chemical carcinogenesis     102891589   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102891589   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102891589   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102891589  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102891589 Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102891589 Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102891589 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 Motif Other DBs NCBI-GeneID:  102891589 NCBI-ProteinID:  XP_024898601 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MEEWGSEKQTYLYVPIRKALFNSQNPEPEVMVAKPKLYYFRGRGRMESIRWLLAAAGVEL GSLVGKEGGLKKNFLKQESSMRSCRRILKDHGEDFLVGNKFSWADIQLLETILMVEELNA SVLSDFPLLKAFKTRISNIPTIKKFLQLGSQKKLPPDSHYVEVVRNILQF NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggaggagtggggctcggaaaaacaaacatatttatatgtacccatccgtaaggctctg ttcaattcccaaaaccctgagccagaagtcatggtagccaaacccaagctttactacttt cgtggcaggggcaggatggagtcaatccgctggctgctggctgcagctggagtggagcta ggttccttggttggaaaggaaggaggtttgaagaagaatttcttgaaacaagagagcagt atgagaagttgcagaaggattttgaaagaccatggagaggattttctcgttggcaataaa ttcagttgggcagacatacaactgttggaaactattttaatggtcgaagaacttaatgct tctgttctttcagacttccctctgctaaaggcatttaaaacaagaatcagcaacatccct acaattaagaagttcctacagctgggaagtcaaaagaagctgcccccggatagccactat gtcgaagtagtcaggaacattctgcagttctaa

Pteropus alecto (black flying fox): 102893685 Help Entry 102893685         CDS       T02993                                  Gene name GSTM4 Definition (RefSeq) glutathione S-transferase Mu 4 isoform X3   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102893685 (GSTM4)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102893685 (GSTM4)    00982 Drug metabolism - cytochrome P450     102893685 (GSTM4)    00983 Drug metabolism - other enzymes     102893685 (GSTM4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102893685 (GSTM4)    05204 Chemical carcinogenesis     102893685 (GSTM4)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102893685 (GSTM4)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102893685 (GSTM4)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102893685 (GSTM4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102893685 (GSTM4) Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102893685 (GSTM4) Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102893685 (GSTM4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N GST_C GST_C_3 GST_C_6 GST_N_3 GST_C_2 WD40_alt Motif Other DBs NCBI-GeneID:  102893685 NCBI-ProteinID:  XP_006919672 UniProt:  L5K3H4 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MTMTLGYWDIRGLAHAIRLLLEYTASNYEEKKYTMGDAPDYDRSQWLSEKFQLGLDFPNL PYLIDGSHRLTQSNAILRYIARKHNLCGETEEEKIRVDILENEVMDVSNQLAGVCYSPDF EKLKPEYLKALPEKMKLFSQFLGKRSWFAADKPTYVDFLAYDILDLHRIFEPKYLDAFPN LKDFVVRLEGLEKISAYMKSSRFIPSPLYTKIAVWGNK NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgaccatgactttgggttactgggatatccgcgggctggctcacgccatccgcctgctc ctggagtacacagcctccaactatgaggagaagaagtacacgatgggggacgctcccgac tatgacagaagccagtggctgagcgaaaaattccagctgggcctcgacttccccaatctg ccctacttaattgacgggtctcacaggctcacccagagcaacgccatccttcgctacatt gctcgcaagcacaacctatgtggggagacagaagaggagaagattcgtgtggacattttg gagaatgaggttatggacgtatccaatcagctggctggagtctgctatagccctgacttt gagaaactgaagcctgagtacttgaaggcactccccgaaaagatgaagctcttctcacag tttctggggaagaggtcttggtttgcagcggacaagcccacctatgtggatttcctggct tatgacatcctagacctgcaccgtatatttgagcccaagtacctggacgcgttcccaaac ctgaaggactttgtggtccgcttagagggcctggagaagatctccgcctacatgaagtcc agtcgtttcatcccaagtcctttgtatacaaagattgcagtgtggggcaacaagtag

Pteropus alecto (black flying fox): 102894088 Help Entry 102894088         CDS       T02993                                  Definition (RefSeq) glutathione S-transferase Mu 5   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102894088   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102894088    00982 Drug metabolism - cytochrome P450     102894088    00983 Drug metabolism - other enzymes     102894088  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102894088    05204 Chemical carcinogenesis     102894088   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102894088   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102894088   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102894088  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102894088 Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102894088 Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102894088 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N GST_C GST_C_3 GST_N_3 GST_C_6 Motif Other DBs NCBI-GeneID:  102894088 NCBI-ProteinID:  XP_006919673 UniProt:  L5K5Y6 LinkDB All DBs Position Unknown AA seq 226 aa AA seqDB search MSSSKSAVVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDL DFPNLPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLTRLC YNPDHEKLKPQYLEQLPVQLKQFSLFLGKFSWFAGEKLTFVDFLTYDVLDQNRMFEPKCL EEFPNLKAFMCRFEALEKIAAYMQSDRFFKMPINNKMAQWGQKRTC NT seq 681 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtccaagtcggctgtggttctcggttactgggatattcgcgggctggcgcac gccatccgcttgctcctggagttcaccgatacttcctacgaggagaaacggtacacgtgt ggggaagctcccgactatgatagaagccagtggctggacgtgaaattcaagctggacctg gacttccctaacctgccatacctcatggacggtaagaataagatcacccagagcaatgcc atcttgcgctacatcgctcgcaagcacaatatgtgcggtgatactgaagaagaaaagatt cgagtggacattatggagaaccaaataatggacttccgcatgcagctaacacgactctgc tacaaccctgaccatgaaaaattgaagcctcaatacttggaacagctgcctgtacaactg aaacaattctccttgttcctggggaaattctcatggtttgcaggagaaaagctcaccttt gtggattttctcacctatgatgtcttagatcagaaccgcatgtttgagcccaagtgcctg gaggaatttccaaatctgaaggctttcatgtgccgttttgaggctttagagaaaatcgct gcctacatgcaatctgaccgtttcttcaaaatgcccatcaacaacaagatggctcagtgg ggccaaaagagaacatgctga

Pteropus alecto (black flying fox): 102896271 Help Entry 102896271         CDS       T02993                                  Definition (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05215   Prostate cancer pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102896271   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102896271    00982 Drug metabolism - cytochrome P450     102896271    00983 Drug metabolism - other enzymes     102896271  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102896271    05204 Chemical carcinogenesis     102896271   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102896271    05215 Prostate cancer     102896271   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102896271   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102896271  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102896271 Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102896271 Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102896271 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_N GST_N_3 Motif Other DBs NCBI-GeneID:  102896271 NCBI-ProteinID:  XP_024902064 LinkDB All DBs Position Unknown AA seq 231 aa AA seqDB search MPPYTIIYFPVQGRCEAMRMLLADQGQSWKEEVVTKETWLQGPVKASCLYGQLPKFQDGD LTLYQSNAILRHLGRSLGLYGKDQREAALVDMVNDGVEDLRSKYGTFIYTNYVSMGTRGR HVGPTKYYVKELPEHLKPFETLLAQNQGGQAFIVGNQVSGRPCPTPAMPPSSYRWETGAE RAREPFVAGWTLDSFPLLSAYVARLSARPKLKAFLASPEHVNRPINGNNKQ NT seq 696 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccatcatctacttccccgtccaagggcgctgcgaggccatgcgcatg ctgctggctgaccagggccagagctggaaagaggaggtggtgaccaaggagacctggctg cagggccctgttaaggcctcctgcctgtatggacagctccccaagttccaggatggagac ctcaccctataccagtccaatgccatcctgcgccacctgggacgctccctggggctgtat gggaaggaccagcgggaggcggccctggtggacatggtaaatgacggcgtggaggacctc cgcagcaaatacggcaccttcatctacaccaactacgtgagcatgggcaccaggggcagg cacgtgggaccaacaaagtactatgtgaaggagctgccagagcacctgaagccctttgag acgctgctggcccagaaccaggggggccaggccttcatcgtgggcaaccaggtgagtggc cgtccctgtcctacccctgcaatgccaccctcttcttacagatgggagacaggtgcagag agagcacgtgagccatttgttgctgggtggaccttggactccttccccttgctctcggcc tatgtggctcgcctcagtgcccggcccaagctcaaggccttcctggcctcccccgagcat gtaaaccggcccatcaatggcaacaacaaacagtga

Pteropus alecto (black flying fox): 102897012 Help Entry 102897012         CDS       T02993                                  Definition (RefSeq) glutathione S-transferase A3-like   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102897012   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102897012    00982 Drug metabolism - cytochrome P450     102897012    00983 Drug metabolism - other enzymes     102897012  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102897012    05204 Chemical carcinogenesis     102897012   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102897012   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102897012   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102897012  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     102897012 Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102897012 Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    102897012 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N GST_C_3 GST_C GST_N_3 Motif Other DBs NCBI-GeneID:  102897012 NCBI-ProteinID:  XP_024898602 LinkDB All DBs Position Unknown AA seq 295 aa AA seqDB search MAVMIHTVLAVPMESSLWAHCLTSRGNSGCPRELQKLTPTELSNIQGPTSTSPGNLRFEQ KEKGLEKPGDYIMAGKPKLHYFNARGRMESIRWLLAAAGVEFEEKFIETLEDFEKLKKDS GLIFQQVPMVEIDGMKLVQSRAILNYIATKYNLYGKDIKERALIDMYTEGMADLNEMILT LLLCPPNEIDAKIALIKEKVTTRYFPAFEKVLKSHGQDYLVGNKLSRADIYLVELFYYVE EIDPSLLANFPLLKALKTRISNLPTVKKFLQPGSQRKPPTDAKTLEEVKKIFNIK NT seq 888 nt NT seq  +upstreamnt  +downstreamnt atggcagtcatgatccacacggtgttggccgtgccgatggagagttctctttgggcccac tgcctgactagtcgaggtaactctgggtgcccaagggagcttcagaaactgaccccaaca gagctcagcaacattcaaggcccaacttctacgtcaccagggaaccttagatttgaacag aaagagaagggtttagagaaaccaggagactacatcatggcggggaaacccaagcttcac tacttcaatgcacgaggacgaatggagtccatccggtggctcttggctgctgcaggagta gagtttgaagagaaatttatagaaactctagaagactttgaaaagttaaaaaaagatagc ggtttgatattccagcaagtgcccatggtcgaaattgatggaatgaagctggtacagtcc agagccattctcaactacatcgccaccaaatacaacctctatgggaaagacataaaggag agagccctgattgatatgtatacagaaggcatggcagatttgaatgaaatgatcctgact ttgctactatgcccgcccaacgagatagatgccaagatcgccttgatcaaagagaaagta accacccgttatttccctgcctttgaaaaagtgttgaagagccacggacaagactacctg gttggcaacaagttgagcagggctgacatttacctggttgaacttttctactatgtggaa gagattgaccccagccttctggccaacttccctctgctgaaggccctgaaaaccagaatc agcaacctccctactgtgaagaagttcctgcagcctggcagccagaggaagcctcccacg gatgcgaaaacactagaagaagtcaaaaagattttcaatattaaatag

Pteropus alecto (black flying fox): 107195441 Help Entry 107195441         CDS       T02993                                  Definition (RefSeq) glutathione S-transferase theta-1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pale  Pteropus alecto (black flying fox) Pathway pale00480   Glutathione metabolism pale00980   Metabolism of xenobiotics by cytochrome P450 pale00982   Drug metabolism - cytochrome P450 pale00983   Drug metabolism - other enzymes pale01100   Metabolic pathways pale01524   Platinum drug resistance pale05200   Pathways in cancer pale05204   Chemical carcinogenesis pale05225   Hepatocellular carcinoma pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     107195441   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     107195441    00982 Drug metabolism - cytochrome P450     107195441    00983 Drug metabolism - other enzymes     107195441  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107195441    05204 Chemical carcinogenesis     107195441   09162 Cancer: specific types    05225 Hepatocellular carcinoma     107195441   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     107195441   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     107195441  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pale02000]     107195441 Enzymes [BR:pale01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      107195441 Transporters [BR:pale02000]  Other transporters   Pores ion channels [TC:1]    107195441 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N GST_N_3 GST_N_2 nos_propeller_2 Motif Other DBs NCBI-GeneID:  107195441 NCBI-ProteinID:  XP_015442274 LinkDB All DBs Position Unknown AA seq 212 aa AA seqDB search MALELFLDLYLTLSYAIYIFAKNNGIMASVSTEAHGAGTGKHPKSEFLKANSLEKVPALR DGNFLLAESVAILLYLSYKYQIDTHWYPPQLQACTHIREYRVWQHTAIQQPSTNVYLCKS FLPHFLGQPVDATQLVQLLGRLMSALQHQDPEALVAKPFLVTEQVSLVEPTVLTERMQEA HRLVLQPWEPQEAQQEPQLAQELVPRLQERLH NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atggcacttgagctttttctggacctgtacttgaccctgagctatgccatctacattttt gctaagaataatggcattatggcatccgtttcaactgaagcccacggagctggcacgggg aagcacccgaaatcagaattcctgaaggcgaactccctggagaaggtgcctgccctcagg gatgggaacttcctgctggcggagagtgtggccatccttttatacctgagctacaagtac cagatagacacacactggtacccacctcagctgcaagcctgcacccacatcagggagtac cgggtatggcagcacaccgccatccagcagccttccaccaacgtttacctgtgcaagtct ttcctgccccacttcttggggcagcctgtggatgccacacagctggtgcagctgttggga aggctgatgtctgctctgcaacaccaggatccagaggccctggtggccaagcccttcctg gtgactgagcaggtctccctggtggaaccgacggtgctcacggagcggatgcaggaggcc cacaggcttgtacttcaaccttgggaaccccaagaggcccagcaggaaccccagctggcc caggagctggtgccgcggctgcaggagcggctccactga

DBGET integrated database retrieval system