KEGG   Pteropus alecto (black flying fox): 102884900
Entry
102884900         CDS       T02993                                 

Gene name
MMP7
Definition
(RefSeq) matrilysin
  KO
K01397  matrix metalloproteinase-7 (matrilysin, uterine) [EC:3.4.24.23]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04310  Wnt signaling pathway
pale05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102884900 (MMP7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102884900 (MMP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pale01002]
    102884900 (MMP7)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.23  matrilysin
     102884900 (MMP7)
Peptidases and inhibitors [BR:pale01002]
 Metallo peptidases
  Family M10
   102884900 (MMP7)
SSDB
Motif
Pfam: Peptidase_M10 PG_binding_1 Peptidase_M54 Metallopep Peptidase_M66 Reprolysin_3 Reprolysin_5 Peptidase_M57
Other DBs
NCBI-GeneID: 102884900
NCBI-ProteinID: XP_006907573
LinkDB
Position
Unknown
AA seq 263 aa
MQLAVLCAVCLLPSSLALPLPPEAGGMSEPQWEQAQGYLKRFYPSDSKTRGANSLEAKLK
EMQKFFRLPITGMLNSRIIEIMQKPRCGMPDVAEYSLFPESPKWTSKVVTYRIISYTRDL
SHFQVNQLVEKAFEMWSKEIPLHFKRIRWGIADIMIGFARGAHGDSYPFDGPGNTLAHAF
LPGPGLGGDAHFDEDERWTDGSSIGINFLYTATHELGHSLGLGHSSDPNAVMYPTYGDKD
SKDFKLSQDDIKEIQKLYGERSD
NT seq 792 nt   +upstreamnt  +downstreamnt
atgcagctggccgtgctgtgcgcagtgtgcctgctgcccagcagcctggctctgccactt
cccccggaggcaggaggcatgagtgagccacagtgggaacaggctcagggctatctcaag
agattttacccatctgactcaaaaacaaggggtgccaacagtttagaagccaaactcaag
gaaatgcaaaaattctttcgcctccctataactggaatgttaaactcccgcatcatagaa
ataatgcagaagcccagatgtggaatgccagatgttgcagaatactcactattcccagag
agcccaaaatggacttccaaagtagtcacctacaggatcatatcatatactcgagattta
tcacatttccaagtgaatcaactagtggaaaaggccttcgaaatgtggagcaaagagatc
ccactgcacttcaagagaattagatggggaattgctgatatcatgattggctttgcaaga
ggagctcacggggactcctacccatttgatggaccgggaaatacactggctcatgccttt
ttacctggaccaggcctaggaggagatgcccacttcgacgaggatgaacgctggactgat
ggtagcagtataggaattaacttcctatatactgcaactcatgaacttggacattctttg
ggtcttggtcattcgtctgatcctaatgctgtgatgtatccaacctatggagataaagat
tccaaggatttcaaactttcacaagatgacatcaaagaaattcagaaattatatggggag
aggagtgattga

DBGET integrated database retrieval system