KEGG   Pteropus alecto (black flying fox): 102885647
Entry
102885647         CDS       T02993                                 

Gene name
KAT2B
Definition
(RefSeq) histone acetyltransferase KAT2B
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04330  Notch signaling pathway
pale04919  Thyroid hormone signaling pathway
pale05166  Human T-cell leukemia virus 1 infection
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102885647 (KAT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102885647 (KAT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102885647 (KAT2B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102885647 (KAT2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pale03021]
    102885647 (KAT2B)
   03036 Chromosome and associated proteins [BR:pale03036]
    102885647 (KAT2B)
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102885647 (KAT2B)
Transcription machinery [BR:pale03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102885647 (KAT2B)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102885647 (KAT2B)
   HAT complexes
    PCAF complex
     102885647 (KAT2B)
    STAGA complex
     102885647 (KAT2B)
    TFTC complex
     102885647 (KAT2B)
    SAGA complex
     102885647 (KAT2B)
    SLIK complex
     102885647 (KAT2B)
    ADA-HAT complex
     102885647 (KAT2B)
    HAT-A2 complex
     102885647 (KAT2B)
    ATAC complex
     102885647 (KAT2B)
SSDB
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Other DBs
NCBI-GeneID: 102885647
NCBI-ProteinID: XP_024899374
LinkDB
Position
Unknown
AA seq 841 aa
MFLYDYKAYTLDRVIGTVHCHLLRFYQLPPMLKHFADHDFASIPSPIADRVSLLVHGAEL
QLESWNHQGSPVARDPAVFQGPQESGLSLSRWTSLELSTPWTFAWGSGTEAEESCKCNGW
KNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYL
FTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQY
KFSHLPSKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNV
PQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLS
MLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSNSSSLEQPNGGST
SPSCKGSSGLEANPGEKRKMNDTHVLEEAKKPRVMGDIPMELIDEVMSTITDPAAMLGPE
TNFLSAHSARXXXXXXXXXXGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPK
EYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMN
HLKEYHIKHNILNFLTYADEYAIGYFKKQGFSKEIKIPRTKYVGYIKDYEGATLMGCELN
PRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGW
KPSGKEKSKEPKDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLK
TMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID
K
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgtttttatatgactataaggcctacactcttgaccgtgtcattggtactgtacactgt
cacctgcttcgtttctaccaacttccacctatgctgaaacattttgctgaccatgacttt
gcctctattccttctcctattgctgatcgggtttcccttctggtccatggggcagagttg
cagctggagtcttggaaccatcaaggctcacctgtggcccgggacccagctgtgttccag
ggacctcaggagtctggcttgtcactctccagatggacttccttggaactgagcactcca
tggacatttgcttggggcagtggtaccgaagctgaggaatcttgtaaatgtaatggctgg
aaaaaccccaacccttctcccactccccccagagccgatctgcagcaaataattgtcagt
ctgacagagtcctgccggagttgtagccacgccctagctgcccatgtttcgcacttggag
aatgtgtcagaggaagaaatgaaccgactcctgggaatagtgttggatgtggaatatctc
tttacctgtgtccacaaggaagaggatgcagataccaaacaagtttatttctacctattc
aagctcttgagaaagtctattttacaaagaggaaaacctgtggttgaaggctctttggag
aagaaacccccatttgaaaaacctagtattgaacagggtgtgaataactttgtacagtac
aaatttagtcaccttccatccaaagaaaggcaaacaatagttgaattggcaaaaatgttc
ctaaaccgcatcaactattggcatttggaggcaccatctcaacgaagactgcgatctccc
aatgatgatatttctggatacaaagagaactacacaaggtggctgtgttattgcaacgtg
ccacagttctgtgacagtctgcctcggtatgaaaccacccaggtgtttgggagaacactg
cttcgctcagtcttcaccgtaatgagacgacaactcctggaacaagcaagacaggaaaaa
gacaaactgccacttgagaaacgaactctaatcctcactcatttcccaaagtttctgtcc
atgttagaagaagaagtttacagtcaaaactcacccatctgggatcaggattttctctcg
gcgtcttccagaaccagccagctaggaatccaaacagtcatcaatccaccccctgttgct
gggacaatttcatacaattcaaactcatcttcccttgagcagccgaatggaggaagcacc
agtccttcctgcaaaggctcttctgggcttgaggcaaacccaggagaaaagaggaaaatg
aatgacactcatgtattggaggaggccaagaaaccccgagttatgggggatattccaatg
gaattgattgacgaggtcatgtctaccatcacagaccctgcagcaatgctgggaccagag
accaattttctgtcagcacattcagccaggnnnnnnnnnnnnnnnnnnnnnnnnnnnngg
ggtgtgattgaatttcacgtggtcggcaattccctgaaccagaaacccaacaagaagatc
ctgatgtggctggttggactacagaatgtattctcccatcagctgccccgaatgccaaaa
gagtacatcacacggcttgtctttgacccgaaacacaaaacccttgctttaattaaagac
ggccgtgttattggtggtatctgtttccgtatgttcccatcacaaggattcacagagatt
gttttctgtgctgtaacctcaaatgagcaagtcaagggctatggaacacacctgatgaat
catttgaaagaatatcatataaaacataacatcctgaacttcctcacgtatgcagatgaa
tatgcaattggatatttcaagaaacagggtttctccaaagaaattaaaatacctagaacc
aaatatgttggctacatcaaggattatgaaggagccactttaatgggatgtgagctaaac
ccgcggatcccatacacagaattttctgtcatcattaagaaacagaaggagatcattaaa
aagctgatagaaagaaaacaagctcagattcgaaaagtctaccctggactttcgtgtttt
aaagatggagttcgacagattccaatagaaagcattcctggaattagagagacaggctgg
aaaccgagtggaaaagagaaaagtaaagagcccaaagatcctgatcagctttacagcacc
ctcaagagcatcctccagcaggtgaagagccatcaaagtgcttggcccttcatggaaccc
gtaaagagaacagaagctccgggatattatgaagttataaggttccccatggatctgaaa
accatgagtgaacgcctcaagaataggtactacgtgtctaagaagttattcatggcagac
ttacaacgagtctttaccaattgcaaagagtacaacccccctgagagtgaatactacaaa
tgtgccaatatcctggagaaattcttcttcagtaaaattaaggaagctggattaattgac
aagtga

KEGG   Pteropus alecto (black flying fox): 102885891
Entry
102885891         CDS       T02993                                 

Gene name
KAT2A
Definition
(RefSeq) histone acetyltransferase KAT2A isoform X1
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04330  Notch signaling pathway
pale04919  Thyroid hormone signaling pathway
pale05166  Human T-cell leukemia virus 1 infection
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102885891 (KAT2A)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102885891 (KAT2A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102885891 (KAT2A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102885891 (KAT2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pale03021]
    102885891 (KAT2A)
   03036 Chromosome and associated proteins [BR:pale03036]
    102885891 (KAT2A)
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102885891 (KAT2A)
Transcription machinery [BR:pale03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102885891 (KAT2A)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102885891 (KAT2A)
   HAT complexes
    PCAF complex
     102885891 (KAT2A)
    STAGA complex
     102885891 (KAT2A)
    TFTC complex
     102885891 (KAT2A)
    SAGA complex
     102885891 (KAT2A)
    SLIK complex
     102885891 (KAT2A)
    ADA-HAT complex
     102885891 (KAT2A)
    HAT-A2 complex
     102885891 (KAT2A)
    ATAC complex
     102885891 (KAT2A)
SSDB
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 T2SSM
Other DBs
NCBI-GeneID: 102885891
NCBI-ProteinID: XP_006924672
LinkDB
Position
Unknown
AA seq 838 aa
MAEPSQASTPAPAAQPRPLQSPAPAPISTPTPSQTSAPTPVPTPAPAPAPAAAPAGSTGT
GGPGVGSGGTGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPATVSAAVVPSTPIFSPTMGGGSNSSLS
LDSGGTEPMPAGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSL
LSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYI
ARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLK
EYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRI
PYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPL
GKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMT
ERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2517 nt   +upstreamnt  +downstreamnt
atggcggaaccttcccaggcctcgaccccggccccggccgcgcagccccgtccccttcag
tccccagcccctgccccaatttcgactcctacccctagccagacttcggcgccgactccg
gttcccactccggcaccagcccccgccccagctgcagccccagccgggagcaccgggacg
ggggggcctggggtaggaagtggggggactgggagcgggggcgatccggctcgacctggc
ttgagccagcagcagcgcgccagccagaggaaggcacaagtccgggggctgccgcgcgcc
aagaagcttgagaagctaggggtcttctcggcttgcaaggccaatgaaacttgcaagtgc
aatggctggaaaaaccccaagccccccactgcacctcgcatggacctgcagcagccagct
gccaacctgagtgagctgtgccgcagctgtgagcaccccttggctgaccatgtgtcgcac
ttagagaatgtgtcagaggatgagattaaccggctgctggggatggtggtagatgtggag
aatctgttcatgtctgttcacaaggaggaggacacggacactaagcaggtctatttctac
ctcttcaagctcctgcggaaatgcatcctacagatgactcggcctgtggtggaggggtct
ctgggcagccccccgtttgagaagcctaatattgagcagggtgtgctaaacttcgtgcag
tacaagttcagtcacctggctccccgggagcggcagacaatgtttgagctctcaaagatg
ttcctgctctgccttaactactggaagcttgagacaccagcccaatttcggcagaggtct
caggctgaggatgtggctacctacaaggtcaattataccagatggctctgttactgccac
gtgccccagagctgcgatagcctcccccgctatgagaccactcacgtctttgggcgaagc
cttctccgctccatcttcactgtcacccggcggcagctgctagagaagttccgggtggag
aaggacaagctggtgcccgagaagaggaccctcatcctcacccacttccccaaattcctg
tccatgctggaggaggagatctacggggcaaactctccgatctgggagtcaggcttcacc
atgccgccctcagaggggacccagctggtgccccggcccgctacagtcagcgcagcagtt
gttcctagcacccccatcttcagccccacaatgggtgggggcagcaacagctccttgagt
ttggattccggaggtaccgagcccatgccagcaggcgagaagaggaagcttccagagaac
ctaaccctggaagatgccaagcggctccgtgtgatgggcgacatcccaatggagctggtc
aacgaggtcatgctcaccatcactgaccctgctgccatgctggggcccgagactagcctg
ctgtcagccaacgcagcccgggatgagacagcccgtctggaggagcgccgcggcatcatc
gagttccatgtcatcggcaactcgctgacgcccaaggccaaccggcgggtgttgctctgg
cttgtggggctgcagaatgtcttctcccaccagctgccacgcatgcccaaggagtatatc
gcccgcctcgtctttgacccgaagcacaagactctggccttgatcaaggacgggcgagtc
attggtgggatctgcttccgcatgtttcccactcagggcttcacagagattgtcttctgt
gctgtcacctcaaacgaacaggtcaaggggtatgggactcacctgatgaaccacctgaag
gagtatcacatcaaacacaacatcctctacttcctcacctatgctgatgagtatgccatt
ggctacttcaaaaagcagggcttttccaaggacatcaaggtgccgaagagccgctacttg
ggctacatcaaggactacgagggggcaacactgatggagtgtgagctaaatccccgcatc
ccctacacggagctctcccacatcatcaagaagcagaaagagattatcaagaagctgatt
gagcgcaaacaggcgcagattcgaaaagtctaccccgggctcagctgcttcaaggagggt
gtgaggcagatccctgtggagagtgtccccggcattcgagagacaggctggaaaccgctg
gggaaggagaaggggaaggagctgaaggaccctgaccagctctacacaaccctcaaaaac
ctgctggcccaaatcaagtcacaccccagtgcctggcccttcatggagccggtgaagaag
tcggaggcccctgactactacgaggtcatccgcttccccattgacctgaagaccatgacg
gaacgattgcgcagccgttactacgtgacccggaagctctttgtggctgacctgcagcgg
gtcatcgccaactgccgcgagtacaaccccccggacagcgagtactgccgctgcgccagt
gccctggagaagttcttctacttcaagctcaaggagggggggctcattgacaagtag

DBGET integrated database retrieval system