Pteropus alecto (black flying fox): 102887365 Help Entry 102887365         CDS       T02993                                  Name (RefSeq) histone H2B   KO K11252   histone H2B Organism pale  Pteropus alecto (black flying fox) Pathway pale04613   Neutrophil extracellular trap formation pale05034   Alcoholism pale05203   Viral carcinogenesis pale05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pale00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102887365  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102887365   09163 Immune disease    05322 Systemic lupus erythematosus     102887365   09165 Substance dependence    05034 Alcoholism     102887365  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pale03036]     102887365   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pale04147]     102887365 Chromosome and associated proteins [BR:pale03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102887365 Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102887365 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TAF TFIID_20kDa Motif Other DBs NCBI-GeneID:  102887365 NCBI-ProteinID:  XP_006921020 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search SPRKHPRKAPDQKTPRRPRRRCSDTFTTYFPRVLKNVHQGPSLSREAVSVMDSFVEDIFQ RIAEEASRLARKTQRATMTSRDIQTAVRLPLPGEMGKHALSEATKTVLRSSLCLIRQQIK CRSSYKNPSVFCQVG NT seq 409 nt NT seq  +upstreamnt  +downstreamnt aagcccacggaagcacccccgaaaggcccctgaccagaagacgccaaggcgcccgcgccg ccgctgctccgacactttcaccacctatttcccccgggttctgaagaacgttcaccaggg cccgagcctgtcgcgggaggccgtgagcgtcatggattcgttcgtggaggacatcttcca gcgcatcgccgaagaggcctcgcgcctggcccgcaaaacccagcgcgccaccatgacctc cagagacatccagacggccgtgaggctgcccctgcccggggagatgggcaagcacgcctt gtccgaggccaccaagaccgtcctccgaagttcattatgtctgatacgacaacagataaa gtgcagaagcagttacaagaatccatccgtcttctgtcaggtcggatag

DBGET integrated database retrieval system