Pteropus alecto (black flying fox): 107195713 Help Entry 107195713         CDS       T02993                                  Symbol CENPX Name (RefSeq) centromere protein X   KO K15360   centromere protein X Organism pale  Pteropus alecto (black flying fox) Pathway pale03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:pale00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     107195713 (CENPX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pale03400]     107195713 (CENPX) DNA repair and recombination proteins [BR:pale03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      107195713 (CENPX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  107195713 NCBI-ProteinID:  XP_015445190 LinkDB All DBs Position Unknown AA seq 90 aa AA seqDB search MPKGSATVGAGGKLLSPTGPQELTSKLLHLHFKDDKTKVSGDALLLMAELLRIFVVEAAV RSVRQAQAEDLARVDVDQLEKVLPQLLLDF NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgcctaaggggtctgccaccgtgggggctggtggtaagctgctgtcgcccactggtccc caggagctgactagcaagctgttgcacctgcacttcaaggatgacaagaccaaagtcagt ggggacgcgctgctgctcatggcggagttgctgaggatcttcgttgtggaagcggccgtc cgcagtgtccggcaggcccaggcagaggacctggcccgtgtggacgtggaccagctggag aaggtgctgcctcagctgctgctggacttctag

DBGET integrated database retrieval system